Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse kidney tissue, human kidney tissue, L02 cells |
| Positive IP detected in | mouse kidney tissue |
| Positive IHC detected in | human spleen tissue, human lung tissue, human ovary tissue, human placenta tissue, human skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse kidney tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 37 publications below |
| IHC | See 2 publications below |
| IF | See 1 publications below |
Product Information
15965-1-AP targets BHMT in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, chicken, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8738 Product name: Recombinant human BHMT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-406 aa of BC012616 Sequence: MPPVGGKKAKKGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQEVNEAACDIARQVADEGDALVAGGVSQTPSYLSCKSETEVKKVFLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKPVAATMCIGPEGDLHGVPPGECAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAARLKAHLMSQPLAYHTPDCNKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ 相同性解析による交差性が予測される生物種 |
| Full Name | betaine-homocysteine methyltransferase |
| Calculated molecular weight | 406 aa, 45 kDa |
| Observed molecular weight | 45-50 kDa |
| GenBank accession number | BC012616 |
| Gene Symbol | BHMT |
| Gene ID (NCBI) | 635 |
| RRID | AB_2290472 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q93088 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Betaine-homocysteine methyltransferase (BHMT) is a cytosolic enzyme that Involved in the regulation of homocysteine metabolism. BHMT catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. This reaction is also required for the irreversible oxidation of choline(PMID: 8798461, 10529246).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for BHMT antibody 15965-1-AP | Download protocol |
| IHC protocol for BHMT antibody 15965-1-AP | Download protocol |
| IP protocol for BHMT antibody 15965-1-AP | Download protocol |
| WB protocol for BHMT antibody 15965-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell mTORC1 stimulates cell growth through SAM synthesis and m6A mRNA-dependent control of protein synthesis. | ||
NPJ Sci Food Ablation of the gut microbiota alleviates high-methionine diet-induced hyperhomocysteinemia and glucose intolerance in mice | ||
J Anim Sci Biotechnol Dietary betaine activates hepaticVTGIIexpression in laying hens associated with hypomethylation ofGRgene promoter and enhancedGRexpression. | ||
J Agric Food Chem Mitotically stable modification of DNA methylation in IGF2/H19 imprinting control region is associated with activated hepatic IGF2 expression in offspring rats from betaine-supplemented dams. | ||
J Agric Food Chem Maternal Betaine Supplementation during Gestation Enhances Expression of mtDNA-Encoded Genes through D-Loop DNA Hypomethylation in the Skeletal Muscle of Newborn Piglets. | ||
Sci Rep Abnormally activated one-carbon metabolic pathway is associated with mtDNA hypermethylation and mitochondrial malfunction in the oocytes of polycystic gilt ovaries. |














