Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse brain tissue, mouse cerebellum tissue, PC-12 cells, SH-SY5Y cells, rat brain tissue, rat cerebellum, C6 cells |
| Positive IHC detected in | mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 185 publications below |
| IHC | See 14 publications below |
| IF | See 27 publications below |
| ELISA | See 1 publications below |
Product Information
28205-1-AP targets BDNF in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28276 Product name: Recombinant human BDNF protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 129-247 aa of BC029795 Sequence: HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR 相同性解析による交差性が予測される生物種 |
| Full Name | brain-derived neurotrophic factor |
| Calculated molecular weight | 247 aa, 28 kDa |
| Observed molecular weight | 28-30 kDa |
| GenBank accession number | BC029795 |
| Gene Symbol | BDNF |
| Gene ID (NCBI) | 627 |
| RRID | AB_2818984 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23560 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
1) What is BDNF?
BDNF (brain-derived neurotrophic factor) is a small secreted growth factor that is important for the development and plasticity of the central nervous system and vital for long-term memory. Selected polymorphisms of BDNF have been shown to increase susceptibility to memory impairment and selected eating and mental disorders.
2) FAQs for BDNF
A) I can detect more than one band in my samples
BDNF is a neurotrophin that is a subject of maturation by proteolytic cleavage. The precursor protein (pre-proBDNF) is first cleaved to proBDNF (~34 kDa) by removing a signal peptide, and then to a mature form of BDNF (14 kDa). Additionally, (pre-)proBDNF can form dimers that run between 50 and 60 kDa, and a minor truncated form of proBDNF running at 28 kDa has also been reported (PMID: 11152678).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for BDNF antibody 28205-1-AP | Download protocol |
| WB protocol for BDNF antibody 28205-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Mater Flexible Living Artificial Dura Mater for Efficient Therapy of Central Nervous System Injury Based on Neuronal Differentiation and Neuroprotective A2 Astrocyte Activation. | ||
Autophagy Trehalose induces autophagy via lysosomal-mediated TFEB activation in models of motoneuron degeneration. | ||
Nat Commun Migration of CD8 + TSCM cells into intestine via PPBP-CXCR2 axis increases host stress susceptibility by inhibiting gut microbiome-derived homovanillic acid. | ||
Redox Biol Design of anti-depressant phosphodiester amino acidic Keap1-Nrf2 protein-protein interaction inhibitors | ||
Theranostics Dopamine receptor 1 on CaMKII-positive neurons within claustrum mediates adolescent cocaine exposure-induced anxiety-like behaviors and electro-acupuncture therapy | ||
MedComm (2020) Enhanced effect of combining bone marrow mesenchymal stem cells (BMMSCs) and pulsed electromagnetic fields (PEMF) to promote recovery after spinal cord injury in mice |