Validation Data Gallery
Tested Applications
| Positive WB detected in | Raji cells |
| Positive IP detected in | Raji cells |
| Positive IHC detected in | human tonsillitis tissue, human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:3000-1:12000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 17 publications below |
| IHC | See 4 publications below |
| IF | See 1 publications below |
| IP | See 2 publications below |
Product Information
21187-1-AP targets BCL6 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15519 Product name: Recombinant human BCL6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 183-532 aa of BC150184 Sequence: SLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVRMPVANPFPKERALPCDSARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEPENLDLQSPTKLSASGEDSTIPQASRLNNIVNRSMTGSPRSSSESHSPLYMHPPKCTSCGSQSPQHAEMCLHTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEAS 相同性解析による交差性が予測される生物種 |
| Full Name | B-cell CLL/lymphoma 6 |
| Calculated molecular weight | 706 aa, 79 kDa |
| Observed molecular weight | 79-95 kDa |
| GenBank accession number | BC150184 |
| Gene Symbol | BCL6 |
| Gene ID (NCBI) | 604 |
| RRID | AB_2878827 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P41182 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
BCL6, a zinc finger transcription factor, contains a N-terminal BTB/POZ domain and C-terminal zinc finger DNA-binding motifs and represses transcription of a wide range of target proteins and microRNAs. BCL6 protein has been reported as a master regulator of B lymphocyte development and growth, and altered BCL6 protein expression was implicated in pathogenesis of diverse human hematologic malignancies, especially in the diffuse large B cell lymphoma (DLBCL). BCL6 is required for the development of T follicular helper T cells (TFH), a helper T cell subset required for the formation of mature and productive GCs. BCL6 has also been shown to play important regulatory roles in macrophages.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for BCL6 antibody 21187-1-AP | Download protocol |
| WB protocol for BCL6 antibody 21187-1-AP | Download protocol |
| IHC protocol for BCL6 antibody 21187-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun A truncating mutation in the autophagy gene UVRAG drives inflammation and tumorigenesis in mice. | ||
Respir Res Transcriptional inhibition of miR-486-3p by BCL6 upregulates Snail and induces epithelial-mesenchymal transition during radiation-induced pulmonary fibrosis. | ||
Sci Rep Specific immunotherapy in combination with Clostridium butyricum inhibits allergic inflammation in the mouse intestine. | ||
Front Cell Dev Biol Development of a contacting transwell co-culture system for the in vitro propagation of primary central nervous system lymphoma | ||
Front Cell Dev Biol The Construction and Analysis of ceRNA Network and Patterns of Immune Infiltration in Colon Adenocarcinoma Metastasis. | ||
Front Oncol Whole-Exome Sequencing Reveals New Potential Mutations Genes for Primary Mucosa-Associated Lymphoid Tissue Lymphoma Arising From the Kidney. |







