Validation Data Gallery
Tested Applications
| Positive WB detected in | A431 cells, HEK-293 cells, HeLa cells |
| Positive IP detected in | A431 cells |
| Positive IHC detected in | human breast cancer tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 9 publications below |
| IHC | See 2 publications below |
| IF | See 5 publications below |
| IP | See 2 publications below |
| CoIP | See 2 publications below |
Product Information
26417-1-AP targets BAG6 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24525 Product name: Recombinant human BAG6 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-184 aa of BC003133 Sequence: MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGPGASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLLSRME 相同性解析による交差性が予測される生物種 |
| Full Name | HLA-B associated transcript 3 |
| Calculated molecular weight | 119 kDa |
| Observed molecular weight | 150 kDa |
| GenBank accession number | BC003133 |
| Gene Symbol | BAT3/BAG-6 |
| Gene ID (NCBI) | 7917 |
| RRID | AB_2880508 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P46379 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
BAT3 also known as Scythe or BAG6, is a nuclear protein implicated in the control of apoptosis and natural killer (NK) cell-dendritic cell (DC) interaction. BAT3 was first discovered as a member of a group of genes located within the class III region of the human major histocompatibility complex on chromosome 6, and has been extensively studied for its role in regulating apoptosis under various stress conditions such as DNA damage and endoplasmic reticulum-related stress. BAT3 has been shown to be required for p53 acetylation, which is critical for the enhancement of p53 transcriptional activity in response to DNA damage. In addition, BAT3 is involved in the regulation of development and reproduction of mammals by acting as a co-chaperone of the heat shock protein HSP70.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for BAG6 antibody 26417-1-AP | Download protocol |
| IHC protocol for BAG6 antibody 26417-1-AP | Download protocol |
| IP protocol for BAG6 antibody 26417-1-AP | Download protocol |
| WB protocol for BAG6 antibody 26417-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Clin Invest Chromosomal 3q amplicon encodes essential regulators of secretory vesicles that drive secretory addiction in cancer | ||
Clin Transl Med Deubiquitinase USP19 modulates apoptotic calcium release and endoplasmic reticulum stress by deubiquitinating BAG6 in triple negative breast cancer | ||
EMBO Rep UBXN1 maintains ER proteostasis and represses UPR activation by modulating translation | ||
Mol Cell Biol The VCP-UBXN1 complex mediates triage of ubiquitylated cytosolic proteins bound to the BAG6 complex.
| ||
Exp Eye Res Retinitis pigmentosa 2 pathogenic mutants degrade through BAG6/HUWE1 complex.
|







