Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse liver tissue, rat liver tissue |
| Positive IHC-Autostainer detected in | human liver tissue |
| Positive IHC detected in | mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse liver tissue, rat liver tissue |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC)-AUTOSTAINER | IHC-AUTOSTAINER : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IF | See 2 publications below |
Product Information
82975-1-RR targets Arginase-1 in WB, IHC, IHC-Autostainer, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag8595 Product name: Recombinant human ARG1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-236 aa of BC005321 Sequence: MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK 相同性解析による交差性が予測される生物種 |
| Full Name | arginase, liver |
| Calculated molecular weight | 236aa,25 kDa; 322aa,35 kDa |
| Observed molecular weight | 35-36 kDa |
| GenBank accession number | BC005321 |
| Gene Symbol | Arginase-1 |
| Gene ID (NCBI) | 383 |
| RRID | AB_3670723 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P05089 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Arginase-1 (Liver arginase) belongs to the arginase family. ARG1 is a novel immunohistochemical marker of hepatocellular differentiation in fine needle aspiration cytology and a marker of hepatocytes and hepatocellular neoplasms. ARG1 is closely associated with alternative macrophage activation and ARG1 has been shown to protectmotor neurons from trophic factor deprivation and allow sensory neurons to overcome neurite outgrowth inhibition by myelin proteins (PMID: 20071539, PMID:12098359). It can exsit as a homotrimer and it has 3 isoforms produced by alternative splicing (PMID:16141327). Defects in ARG1 are the cause of argininemia (ARGIN). Deletion or TNF-mediated restriction of ARG1 unleashes the production of NO by NOS2, which is critical for pathogen control (PMID:27117406). ARG1 mainly expresses in neurons in a normal brain. The expression of ARG1 increases in microglia/macrophages and astrocytes early after CNS injuries. ARG1 has been regarded as a marker for beneficial microglia/macrophages and possesses antiinflammatory and tissue repair properties under various pathological conditions (PMID: 26538310, PMID: 31619589).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Arginase-1 antibody 82975-1-RR | Download protocol |
| IHC protocol for Arginase-1 antibody 82975-1-RR | Download protocol |
| WB protocol for Arginase-1 antibody 82975-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Phytomedicine Sanmiao pill ameliorates rheumatoid arthritis via PPARγ-mediated lipid accumulation in macrophage: A multi-omics and experimental validation. | ||
J Headache Pain hsa_circ_0006168 drives microglial activation in TNC via miR-99b-5p/KDM6B axis to promote central sensitization in migraine. | ||
Bioact Mater MSC-mimicking nanovesicle embedded bio-adhesive hydrogel for dual immunomodulation and osteogenesis to promote maxillofacial bone regeneration. | ||
Small Morphology-Engineered Ceria Nanoparticles Ameliorate Periodontitis via Enhanced Antioxidant and Anti-Inflammatory Activities. | ||
Front Immunol Histone lactylation-derived TET2 enhanced Arg1-mediated MDSC immunosuppression. | ||
Eur J Pharmacol Study of the ameliorative effect of β-Bisabolene on ischemic stroke via COX-2 with the Keap1/Nrf2 and MAPK pathways |









