Validation Data Gallery
Tested Applications
| Positive WB detected in | human plasma, human urine |
| Positive IHC detected in | human intrahepatic cholangiocarcinoma tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 1 publications below |
| IHC | See 1 publications below |
Product Information
26716-1-AP targets Alpha-1-microglobulin in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25239 Product name: Recombinant human AMBP protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 21-352 aa of BC041593 Sequence: PVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN 相同性解析による交差性が予測される生物種 |
| Full Name | alpha-1-microglobulin/bikunin precursor |
| Calculated molecular weight | 352 aa, 39 kDa |
| Observed molecular weight | 30 kDa |
| GenBank accession number | BC041593 |
| Gene Symbol | Alpha 1 microglobulin |
| Gene ID (NCBI) | 259 |
| RRID | AB_3085894 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P02760 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Alpha-1-microglobulin (A1M) is also named as Protein AMBP, Bikunin, Trypstatin and Inter-alpha-trypsin inhibitor light chain (ITI-LC). A1M belongs to the lipocalin protein family, a group of structural proteins with a similar one-domain fold that are found in bacteria, plants and animals (PMID: 2580349). A1M is recognized as a physiological antioxidant with powerful cell- and tissue-protective properties (PMID: 11877257). Whereas A1M is a heme and radical scavenger, and a reductase, bikunin is a structural component of extracellular matrix and has protease inhibitor and anti-inflammatory properties (PMID: 27988357). In humans, the majority of A1M is synthesized in the liver, but smaller quantities are also expressed in most other cells in the body. In the blood, equal quantities of two forms of A1M can be found: a free monomeric form and a covalent high-molecular weight complex bound to immunoglobulin A, albumin and prothrombin (PMID: 6196366, PMID: 9183005). Endogenous A1M has also been described to be localized ubiquitously in the dermal and epidermal layers of skin, and in syncytiothrophoblasts, monocytes/macrophages, vascular endothelium and extracellular matrix of placental tissue and extracellular matrix (PMID: 22096585,PMID: 21356557). Alpha 1 microglobulin, also known as HI30, is a 27-30 kDa glycoprotein, present in various body fluids. It belongs to the lipocalin superfamily of hydrophobic ligand-binding proteins forming an internal ligand-binding pocket. The protein acts as a mediator of bacterial adhesion to polymer surfaces and is involved in inhibiting renal lithogenesis.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Alpha-1-microglobulin antibody 26716-1-AP | Download protocol |
| WB protocol for Alpha-1-microglobulin antibody 26716-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Medicine (Baltimore) AMBP gene activation promotes cholangiocarcinoma progression through the WNT/β-catenin signaling pathway: Regulatory effect of polysaccharides from Auricularia auricula-judae.
| ||
EBioMedicine Proteomic profiling and molecular reclassification of high-grade serous ovarian cancer identifies prognostic subtypes and immunotherapy biomarkers. |




