Validation Data Gallery
Tested Applications
| Positive WB detected in | human placenta tissue, rat liver tissue, HepG2 cells, L02 cells, human saliva, pig liver tissue, human milk, mouse liver tissue, human plasma, human placenta |
| Positive IP detected in | human plasma tissue |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IHC | See 1 publications below |
| IF | See 3 publications below |
Product Information
66135-1-Ig targets Alpha-1-Antitrypsin in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9516 Product name: Recombinant human Alpha-1-Antitrypsin protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 28-418 aa of BC015642 Sequence: QGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQATTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK 相同性解析による交差性が予測される生物種 |
| Full Name | serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 |
| Calculated molecular weight | 418 aa, 47 kDa |
| Observed molecular weight | 51 kDa |
| GenBank accession number | BC015642 |
| Gene Symbol | Alpha 1-Antitrypsin |
| Gene ID (NCBI) | 5265 |
| RRID | AB_2881534 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P01009 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
SERPINA1 is the gene for a protein called alpha-1-antitrypsin (AAT), which is a serine protease inhibitor whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. AAT is a glycoprotein synthesized primarily by hepatocytes, with smaller amountssynthesized by intestinal epithelial cells, neutrophils, pulmonary alveolar cells and macrophages. AAT is the most abundant, endogenous serine protease inhibitor in blood circulation and it has been implicated in regulating vital fluid phase biological events such as blood coagulation, fibrinolysis, complement activation, apoptosis, reproduction, tumor progression and inflammatory response. The primary function of AAT is thought to be the inactivation of neutrophil elastase and other endogenous serine proteases. Defects in SERPINA1 can cause emphysema or liver disease.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Alpha-1-Antitrypsin antibody 66135-1-Ig | Download protocol |
| IF protocol for Alpha-1-Antitrypsin antibody 66135-1-Ig | Download protocol |
| IHC protocol for Alpha-1-Antitrypsin antibody 66135-1-Ig | Download protocol |
| IP protocol for Alpha-1-Antitrypsin antibody 66135-1-Ig | Download protocol |
| WB protocol for Alpha-1-Antitrypsin antibody 66135-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Liver Int Extensively expanded murine-induced hepatic stem cells maintain high-efficient hepatic differentiation potential for repopulation of injured livers. | ||
Biochem J LMAN1-MCFD2 complex is a cargo receptor for the ER-Golgi transport of α1-antitrypsin. | ||
Dis Markers Differential Plasma Proteins Identified via iTRAQ-Based Analysis Serve as Diagnostic Markers of Pancreatic Ductal Adenocarcinoma | ||
Ann Transl Med Changes in the hepatic differentiation potential of human mesenchymal stem cells aged in vitro. | ||
Ann Transl Med Functional hit 1 (FH1)-based rapid and efficient generation of functional hepatocytes from human mesenchymal stem cells: a novel strategy for hepatic differentiation. | ||
















