Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, human liver tissue, human brain tissue, mouse brain tissue, HEK-293 cells |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse testis tissue, human testis tissue, mouse kidney tissue, rat kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 13 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
15280-1-AP targets ATP6V1E1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7399 Product name: Recombinant human ATP6V1E1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-226 aa of BC004443 Sequence: MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD 相同性解析による交差性が予測される生物種 |
| Full Name | ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1 |
| Calculated molecular weight | 26 kDa |
| Observed molecular weight | 31 kDa |
| GenBank accession number | BC004443 |
| Gene Symbol | ATP6V1E1 |
| Gene ID (NCBI) | 529 |
| RRID | AB_2062545 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P36543 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
ATP6V1E1, also named as ATP6E, ATP6E2 and p31, belongs to the V-ATPase E subunit family. It is a subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. V-ATPase and the lack of mycobacterial phagosome acidification are directly attributed to the Mtb protein tyrosine phosphatase PtpA.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ATP6V1E1 antibody 15280-1-AP | Download protocol |
| IP protocol for ATP6V1E1 antibody 15280-1-AP | Download protocol |
| WB protocol for ATP6V1E1 antibody 15280-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Proc Natl Acad Sci U S A Mycobacterium tuberculosis protein tyrosine phosphatase (PtpA) excludes host vacuolar-H+-ATPase to inhibit phagosome acidification.
| ||
J Biol Chem The ROGDI protein mutated in Kohlschutter-Tonz syndrome is a novel subunit of the Rabconnectin-3 complex implicated in V-ATPase assembly | ||
J Cell Sci Neutral sphingomyelinase 2 controls exosome secretion by counteracting V-ATPase-mediated endosome acidification. | ||
Microorganisms Exopolysaccharides from Bifidobacterium animalis Ameliorate Escherichia coli-Induced IPEC-J2 Cell Damage via Inhibiting Apoptosis and Restoring Autophagy. | ||
J Proteomics iTRAQ-based quantitative proteomic analysis for identification of oligodendroglioma biomarkers related with loss of heterozygosity on chromosomal arm 1p. | ||
Vet Res Butyrate-mediated autophagy inhibition limits cytosolic Salmonella Infantis replication in the colon of pigs treated with a mixture of Lactobacillus and Bacillus. |














