Recombinant human ASIP protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag16357
Synonyms
AGSW; AGTI; AGTIL; ASP; MGC126092; MGC126093; SHEP9
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MDVTRLLLATLLVFLCFFTANSHLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKKRSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC
(1-132aa encoded by BC104238) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
