Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse brain tissue, mouse cerebellum tissue, rat brain tissue | 
| Positive IP detected in | mouse brain tissue | 
| Positive IHC detected in | human pancreas cancer tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below | 
| WB | See 11 publications below | 
| IHC | See 4 publications below | 
| IF | See 3 publications below | 
| FC | See 2 publications below | 
| CoIP | See 2 publications below | 
Product Information
27235-1-AP targets ASIC1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag25941 Product name: Recombinant human ASIC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 464-528 aa of NM_001095 Sequence: MKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC 相同性解析による交差性が予測される生物種 | 
                                    
| Full Name | amiloride-sensitive cation channel 2, neuronal | 
| Calculated molecular weight | 60 kDa | 
| Observed molecular weight | 60-70 kDa, 80-90 kDa | 
| GenBank accession number | NM_001095 | 
| Gene Symbol | ASIC1 | 
| Gene ID (NCBI) | 41 | 
| RRID | AB_2880814 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P78348 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
ASIC1(Acid-sensing ion channel 1), also named as ACCN2, BNaC2 or amiloride-sensitive cation channel 2, is a member of the ASICs family. ASICs, an H+-gated subgroup of the epithelial Na+ channel/degenerin (ENaC/DEG) superfamily, are widely expressed throughout the central and peripheral nervous system and triggered by increased extracellular acidification (PMID: 28518134, 27941930). ASIC1 is a key player in acidosis-induced tumor growth and invasiveness. Clinically, alterations of ASIC1 are associated with poor survival in breast cancer (PMID: 26686084).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ASIC1 antibody 27235-1-AP | Download protocol | 
| IP protocol for ASIC1 antibody 27235-1-AP | Download protocol | 
| WB protocol for ASIC1 antibody 27235-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Research (Wash D C) Targeting ASIC1a Promotes Neural Progenitor Cell Migration and Neurogenesis in Ischemic Stroke | ||
Int Immunopharmacol ASIC1a regulates airway epithelial cell pyroptosis in acute lung injury by NLRP3-Caspase1-GSDMD pathway | ||
Cell Signal Paeoniflorin inhibits pyroptosis of nucleus pulposus cells in an acidic environment and alleviates the degeneration of the intervertebral disc in rats | ||
Lab Invest Acidosis induces synovial fibroblasts to release vascular endothelial growth factor via acid-sensitive ion channel 1a. | ||
Lab Invest ASIC1a promotes the proliferation of synovial fibroblasts via the ERK/MAPK pathway. | ||
Eur J Pharmacol The interaction of ASIC1a and ERS mediates nerve cell apoptosis induced by insulin deficiency.
  | 







