Validation Data Gallery
Tested Applications
| Positive WB detected in | human brain tissue, mouse eye tissue, mouse heart tissue |
| Positive IHC detected in | mouse eye tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF detected in | Retinal organoids, mouse eye tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF) | IF : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IHC | See 5 publications below |
| IF | See 1 publications below |
Product Information
11100-2-AP targets Arrestin C in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1580 Product name: Recombinant human ARR3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC012096 Sequence: MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYFKCRKLFVMLTCAFRYGRDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASS 相同性解析による交差性が予測される生物種 |
| Full Name | arrestin 3, retinal (X-arrestin) |
| Calculated molecular weight | 43 kDa |
| Observed molecular weight | 43 kDa |
| GenBank accession number | BC012096 |
| Gene Symbol | Arrestin C |
| Gene ID (NCBI) | 407 |
| RRID | AB_2289959 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P36575 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Arrestin C, also known as Arrestin 3 or Retinal Cone Arrestin, is a protein encoded by the ARR3 gene. It belongs to the arrestin family, which plays a crucial role in regulating G-protein-coupled receptor (GPCR) signaling and trafficking. Arrestin C is composed of two major domains: the N-domain and the C-domain, connected by a hinge region. These domains form a structure resembling two clamshells placed end-to-end. The C-terminal tail (C-tail) of Arrestin C interacts extensively with the N-domain, stabilizing its basal conformation. Arrestin C is predominantly expressed in cone photoreceptors and pinealocytes in the retina. It is involved in the shut-off mechanisms associated with high-acuity color vision by binding to phosphorylated and activated opsins, thereby inhibiting their ability to interact with transducin.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Arrestin C antibody 11100-2-AP | Download protocol |
| IHC protocol for Arrestin C antibody 11100-2-AP | Download protocol |
| WB protocol for Arrestin C antibody 11100-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun A high-risk retinoblastoma subtype with stemness features, dedifferentiated cone states and neuronal/ganglion cell gene expression. | ||
Cancers (Basel) Clinical, Genomic, and Pharmacological Study of MYCN-Amplified RB1 Wild-Type Metastatic Retinoblastoma. | ||
Invest Ophthalmol Vis Sci Establishment and Comprehensive Characterization of a Novel Preclinical Platform of Metastatic Retinoblastoma for Therapeutic Developments | ||
Free Radic Biol Med Targeting ZIP8 mediated ferroptosis as a novel strategy to protect against the retinal pigment epithelial degeneration | ||
Int J Mol Sci Tridimensional Retinoblastoma Cultures as Vitreous Seeds Models for Live-Cell Imaging of Chemotherapy Penetration. | ||
Front Mol Neurosci A mouse model of cone photoreceptor function loss (cpfl9) with degeneration due to a mutation in Gucy2e |







