Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse brain tissue, COS-7 cells, HEK-293 cells, HeLa cells, rat brain tissue |
| Positive IHC detected in | human breast cancer tissue, human prostate cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 10 publications below |
| WB | See 26 publications below |
| IHC | See 3 publications below |
| IF | See 8 publications below |
| IP | See 3 publications below |
| CoIP | See 2 publications below |
Product Information
10790-1-AP targets ARF1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.
| Tested Reactivity | human, mouse, rat, monkey |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1244 Product name: Recombinant human ARF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-181 aa of BC009247 Sequence: MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK 相同性解析による交差性が予測される生物種 |
| Full Name | ADP-ribosylation factor 1 |
| Calculated molecular weight | 21 kDa |
| Observed molecular weight | 18-21 kDa |
| GenBank accession number | BC009247 |
| Gene Symbol | ARF1 |
| Gene ID (NCBI) | 375 |
| RRID | AB_2227609 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P84077 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
ADP-ribosylation factors (ARFs) are members of the ARF family of GTP-binding proteins of the Ras superfamily, with 20 kDa protein size. ARFs bind and regulate GTP/GDP cycle by alternating between the active GTP-bound and inactive GDP-bound conformations. ARF family proteins are essential and ubiquitous in eukaryotes. Six highly conserved members of the family have been identified in mammalian cells. They function in vesicular traffic and actin remodelling and other bioprocesses in cells. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. It mainly functions in coat recruitment. (PMID: 7759471, PMID: 16042562).This antibody can bind ARFs for the close sequences.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ARF1 antibody 10790-1-AP | Download protocol |
| IHC protocol for ARF1 antibody 10790-1-AP | Download protocol |
| WB protocol for ARF1 antibody 10790-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Host Microbe A Brucella Type IV Effector Targets the COG Tethering Complex to Remodel Host Secretory Traffic and Promote Intracellular Replication.
| ||
EMBO J Transport through recycling endosomes requires EHD1 recruitment by a phosphatidylserine translocase. | ||
Theranostics Anti-allergic drug azelastine suppresses colon tumorigenesis by directly targeting ARF1 to inhibit IQGAP1-ERK-Drp1-mediated mitochondrial fission. | ||
BMC Biol ACBD3 modulates KDEL receptor interaction with PKA for its trafficking via tubulovesicular carrier. | ||
Fertil Steril Pathogenic variants in TSC2 might cause premature ovarian insufficiency through activated mTOR induced hyperactivation of primordial follicles | ||
J Virol N-terminal acetyltransferase 6 facilitates enterovirus 71 replication by regulating PI4KB expression and replication organelle biogenesis |














