Validation Data Gallery
Tested Applications
| Positive WB detected in | A431 cells, HeLa cells, mouse uterus tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human ovary tumor tissue, human breast cancer tissue, human kidney tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 9 publications below |
| IHC | See 8 publications below |
| IF | See 6 publications below |
| CoIP | See 1 publications below |
Product Information
10479-2-AP targets Annexin A11 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0729 Product name: Recombinant human ANXA11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC007564 Sequence: MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANMPNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQPPGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVT 相同性解析による交差性が予測される生物種 |
| Full Name | annexin A11 |
| Calculated molecular weight | 56 kDa |
| Observed molecular weight | 56-60 kDa |
| GenBank accession number | BC007564 |
| Gene Symbol | Annexin A11 |
| Gene ID (NCBI) | 311 |
| RRID | AB_2057171 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P50995 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Annexin A11 (Anxa11) is one member of annexins that are Ca2+-regulated phospholipid-binding proteins. Annexin A11 plays an important role in cell division, differentiation, apoptosis, vesicle trafficking and Ca2+ signaling (PMID: 31610865). ANXA11, an RNA granule-associated phosphoinositide-binding protein, acts as a molecular tether between RNA granules and lysosomes (PMID: 31539493). Annexin A11 dysregulation is involved in the progression, drug-resistance, recurrence of systemic autoimmune disease and cancer. Annexin A11, is involved in a variety of cellular functions including mRNA transport and translation, endocytosis, exocytosis, and plasma membrane repair (PMID: 38896345).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Annexin A11 antibody 10479-2-AP | Download protocol |
| IHC protocol for Annexin A11 antibody 10479-2-AP | Download protocol |
| IP protocol for Annexin A11 antibody 10479-2-AP | Download protocol |
| WB protocol for Annexin A11 antibody 10479-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Sci Transl Med Mutations in the vesicular trafficking protein annexin A11 are associated with amyotrophic lateral sclerosis. | ||
Oncotarget ANXA11 regulates the tumorigenesis, lymph node metastasis and 5-fluorouracil sensitivity of murine hepatocarcinoma Hca-P cells by targeting c-Jun.
| ||
Brain Pathol Dendritic location of dystrophic neurites in FTLD-TDP type C with annexinopathy | ||
FASEB J Non-canonical RNA-binding protein ANXA11 regulates microRNA resorting into small extracellular vesicles to mediate cisplatin resistance | ||
Biomed Pharmacother Annexin A11 knockdown inhibits in vitro proliferation and enhances survival of Hca-F cell via Akt2/FoxO1 pathway and MMP-9 expression.
|















