Validation Data Gallery
Tested Applications
| Positive WB detected in | K-562 cells, rat liver tissue, mouse liver tissue |
| Positive IHC detected in | mouse testis tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse colon tissue, mouse testis tissue |
| Positive IF/ICC detected in | A549 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 118 publications below |
| IHC | See 25 publications below |
| IF | See 18 publications below |
| ELISA | See 2 publications below |
| CoIP | See 1 publications below |
Product Information
15910-1-AP targets ALDH1A1 in WB, IHC, IF/ICC, IF-P, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8665 Product name: Recombinant human ALDH1A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 153-501 aa of BC001505 Sequence: TYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS 相同性解析による交差性が予測される生物種 |
| Full Name | aldehyde dehydrogenase 1 family, member A1 |
| Calculated molecular weight | 501 aa, 55 kDa |
| Observed molecular weight | 50-55 kDa |
| GenBank accession number | BC001505 |
| Gene Symbol | ALDH1A1 |
| Gene ID (NCBI) | 216 |
| RRID | AB_2305276 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P00352 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
ALDH1A1(Aldehyde dehydrogenase family 1 member A1 ), also named as ALDC, ALDH1 and PUMB1, belongs to the aldehyde dehydrogenase family. The ALDH1A1 gene encodes a liver cytosolic isoform of acetaldehyde dehydrogenase, an enzyme involved in the major pathway of alcohol metabolism after alcohol dehydrogenase. ALDH1A1 plays a critical role in protection against oxidative stress-induced cytotoxicity in lens epithelial cells(PMID:19296407). And it is important for multiple biological activities including drug resistance, cell differentiation, and oxidative stress response(PMID:19025616). As a novel cancer stem cell marker, ALDH1A1 can be used for tumors whose corresponding normal tissues express ALDH1 in relatively restricted or limited levels such as breast, lung, ovarian or colon cancer(PMID: 20422001). This antibody can also recognize some other membranes of the aldehyde dehydrogenase family.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ALDH1A1 antibody 15910-1-AP | Download protocol |
| IHC protocol for ALDH1A1 antibody 15910-1-AP | Download protocol |
| WB protocol for ALDH1A1 antibody 15910-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Res Excessive UBE3A dosage impairs retinoic acid signaling and synaptic plasticity in autism spectrum disorders. | ||
Int J Oral Sci LIMP-2 enhances cancer stem-like cell properties by promoting autophagy-induced GSK3β degradation in head and neck squamous cell carcinoma | ||
Nat Commun TSPAN8 promotes cancer cell stemness via activation of sonic Hedgehog signaling. | ||
J Pineal Res Melatonin inhibits the stemness of head and neck squamous cell carcinoma by modulating HA synthesis via the FOSL1/HAS3 axis | ||
EMBO J RASSF1C oncogene elicits amoeboid invasion, cancer stemness, and extracellular vesicle release via a SRC/Rho axis. |












