Validation Data Gallery
Tested Applications
| Positive WB detected in | NIH/3T3 cells, mouse liver tissue |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | NIH/3T3 cells |
| Positive FC (Intra) detected in | NIH/3T3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IHC | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
28113-1-AP targets AKT2 in WB, IHC, IF/ICC, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27005 Product name: Recombinant human AKT2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 335-481 aa of BC120994 Sequence: GLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIRE 相同性解析による交差性が予測される生物種 |
| Full Name | v-akt murine thymoma viral oncogene homolog 2 |
| Observed molecular weight | 56 kDa |
| GenBank accession number | BC120994 |
| Gene Symbol | AKT2 |
| Gene ID (NCBI) | 208 |
| RRID | AB_2881064 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P31751 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
AKT2 is one of 3 closely related serine/threonine-protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, and which regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis and their activation has been observed in a wide variety of cancers. AKT2 is mainly involved in cancer cell survival, apoptosis inhibition, migration and invasion(PMID:21979951). Defects in AKT2 are a cause of susceptibility to breast cancer (BC). AKT2 promotes metastasis of tumor cells without affecting the latency of tumor development. And defects in AKT2 are a cause of non-insulin-dependent diabetes mellitus (NIDDM) and hypoinsulinemic hypoglycemia with hemihypertrophy (HIHGHH). The full length protein has four glycosylation sites.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for AKT2 antibody 28113-1-AP | Download protocol |
| IF protocol for AKT2 antibody 28113-1-AP | Download protocol |
| IHC protocol for AKT2 antibody 28113-1-AP | Download protocol |
| WB protocol for AKT2 antibody 28113-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int J Biochem Cell Biol AKT serine/threonine kinase 2-mediated phosphorylation of fascin threonine 403 regulates esophageal cancer progression. | ||
Biologics ATF3 Knockdown Exacerbates Astrocyte Activation by Inhibiting Phosphorylation of Drp1 in Ischemic Stroke | ||
Chem Res Toxicol Novel Dual PPAR δ/γ Partial Agonist Induces Hepatic Lipid Accumulation through Direct Binding and Inhibition of AKT1 Phosphorylation, Mediating CD36 Upregulation | ||
Oncogene The protection of UCK2 protein stability by GART maintains pyrimidine salvage synthesis for HCC growth under glucose limitation | ||
Acta Odontol Scand Advanced glycation end products induce inflammaging in periodontal ligament fibroblasts through RAGE/AKT/mTOR/glycolysis pathway |




