Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, NIH/3T3 cells, RAW264.7 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 8 publications below |
| IHC | See 2 publications below |
Product Information
15264-1-AP targets ADSL in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7332 Product name: Recombinant human ADSL protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-354 aa of BC000253 Sequence: MAAGGDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIQEMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNT 相同性解析による交差性が予測される生物種 |
| Full Name | adenylosuccinate lyase |
| Calculated molecular weight | 55 kDa |
| Observed molecular weight | 55 kDa |
| GenBank accession number | BC000253 |
| Gene Symbol | ADSL |
| Gene ID (NCBI) | 158 |
| RRID | AB_2225668 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P30566 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
ADSL(adenylosuccinate lyase) is also named as AMPS, ASase, ASL and belongs to the lyase 1 family. It is an enzyme involved in 2 pathways of purine nucleotide metabolism and catalyzes cleavage of succinyl groups to yield fumarate(PMID:18524658). Defects in ADSL are the cause of adenylosuccinase deficiency (ADSL deficiency). In humans, mutations in ADSL lead to an inborn error of metabolism originally characterized by developmental delay, often with autistic features(PMID:20884265)..The ADSL enzymatic activity is reduced in lymphocytes and red blood cells of the patient with severe psychomotor retardation(PMID:9545543). It has 2 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for ADSL antibody 15264-1-AP | Download protocol |
| IF protocol for ADSL antibody 15264-1-AP | Download protocol |
| IHC protocol for ADSL antibody 15264-1-AP | Download protocol |
| WB protocol for ADSL antibody 15264-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell ERK2 Phosphorylates PFAS to Mediate Posttranslational Control of De Novo Purine Synthesis. | ||
Adv Sci (Weinh) LEDGF Binds H3R17me2a Promoting De Novo Nucleotide Biosynthesis in SETD2 Mutant Clear Cell Renal Cell Carcinoma | ||
Front Cell Dev Biol Thyroid Hormone-Regulated Expression of Period2 Promotes Liver Urate Production. | ||
Res Sq Inflammaging-induced TRAF3 degradation impairs AMP biosynthesis to drive sarcopenia. | ||
Research (Wash D C) Notch2 Signaling Drives Cardiac Hypertrophy by Suppressing Purine Nucleotide Metabolism | ||
Cell Death Differ Oxoglutarate dehydrogenase-like inhibits the progression of hepatocellular carcinoma by inducing DNA damage through non-canonical function |






