Validation Data Gallery
Tested Applications
| Positive WB detected in | HL-60 cells, THP-1 cells, Jurkat cells |
| Positive IP detected in | HL-60 cells |
| Positive IHC detected in | human lymphoma tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 6 publications below |
| WB | See 14 publications below |
| IHC | See 2 publications below |
| IP | See 2 publications below |
| CoIP | See 1 publications below |
Product Information
13990-1-AP targets GRK2 in WB, IHC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5071 Product name: Recombinant human ADRBK1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 390-689 aa of BC037963 Sequence: PFRQHKTKDKHEIDRMTLTMAVELPDSFSPELRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARKKAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL 相同性解析による交差性が予測される生物種 |
| Full Name | adrenergic, beta, receptor kinase 1 |
| Calculated molecular weight | 689 aa, 80 kDa |
| Observed molecular weight | 80 kDa |
| GenBank accession number | BC037963 |
| Gene Symbol | ADRBK1 |
| Gene ID (NCBI) | 156 |
| RRID | AB_2225833 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P25098 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
GRK2 (G-protein coupled receptor kinase 2) is also named as ADRBK1 (Beta-adrenergic receptor kinase 1), BARK, and BARK1. G-protein-coupled receptors (GPCRs) transmit extracellular signals across the cell membrane. GPCR kinases (GRKs) desensitize GPCR signals in the cell membrane. GRK2 translocation from the cytoplasm to the cell membrane in response to extracellular signals is critical to the function of the protein, where GRK phosphorylation is an important component of its translocation to the membrane.(PMID:27412951)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for GRK2 antibody 13990-1-AP | Download protocol |
| IHC protocol for GRK2 antibody 13990-1-AP | Download protocol |
| IP protocol for GRK2 antibody 13990-1-AP | Download protocol |
| WB protocol for GRK2 antibody 13990-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Neddylation inhibition induces glutamine uptake and metabolism by targeting CRL3SPOP E3 ligase in cancer cells. | ||
Nat Commun Phospho-selective mechanisms of arrestin conformations and functions revealed by unnatural amino acid incorporation and (19)F-NMR.
| ||
J Pharm Anal Monoclonal antibody targeting mu-opioid receptor attenuates morphine tolerance via enhancing morphine-induced receptor endocytosis
| ||
Oncogene β-Trcp and CK1δ-mediated degradation of LZTS2 activates PI3K/AKT signaling to drive tumorigenesis and metastasis in hepatocellular carcinoma. | ||
J Am Heart Assoc Paroxetine Attenuates Cardiac Hypertrophy Via Blocking GRK2 and ADRB1 Interaction in Hypertension.
| ||
iScience 4-(Methylnitrosamino)-1-(3-pyridyl)-1-butanone provokes progression from chronic pancreatitis to pancreatic intraepithelial neoplasia. |






