Validation Data Gallery
Tested Applications
| Positive WB detected in | pig brain tissue, rat brain tissue, NCI-H1299 cells, mouse brain tissue, JAR cells |
| Positive IHC detected in | mouse heart tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 2 publications below |
| IHC | See 1 publications below |
| IF | See 6 publications below |
Product Information
67417-1-Ig targets ACVR1 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Pig, Mouse, Rat samples.
| Tested Reactivity | Human, Pig, Mouse, Rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13508 Product name: Recombinant human ACVR1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 210-509 aa of BC033867 Sequence: LLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC 相同性解析による交差性が予測される生物種 |
| Full Name | activin A receptor, type I |
| Calculated molecular weight | 509 aa, 57 kDa |
| Observed molecular weight | 57 kDa |
| GenBank accession number | BC033867 |
| Gene Symbol | ACVR1 |
| Gene ID (NCBI) | 90 |
| RRID | AB_2882657 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q04771 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
ACVR1 (activin receptor type I), also known as ALK2 or ACTRI, is a receptor for activin. It forms a stable complex with type II receptor after ligand binding. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. ACVR1 is expressed in many tissues including skeletal muscle and chondrocytes. It functions as a receptor for bone morphogenetic protein (BMP) and induces Indian hedgehog in chondrocytes during skeletal development. Mutations in ACVR1 gene are associated with fibrodysplasia ossificans progressive (PMID: 16642017).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ACVR1 antibody 67417-1-Ig | Download protocol |
| IHC protocol for ACVR1 antibody 67417-1-Ig | Download protocol |
| WB protocol for ACVR1 antibody 67417-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int Immunopharmacol Activin A exacerbates neonatal necrotizing enterocolitis via ALK4-mediated apoptosis and barrier disruption | ||
J Cell Mol Med Circulating exosomes repair endothelial cell damage by delivering miR-193a-5p. | ||
EMBO J GNAS/PKA signaling promotes aberrant osteochondral differentiation of Gli1+ tendon sheath progenitors | ||
Front Mol Biosci Expression and distribution of activin-follistatin-inhibin axis in the urinary bladder | ||
Eur J Histochem Expression of bone morphogenetic protein signaling pathway players in the jejunum and colon of adult rats | ||
Mol Immunol Protocatechuic aldehyde promotes diabetic wound healing by enhancing angiogenesis via H3K18 lactylation-mediated Acvr1c expression.
|









