Validation Data Gallery
Tested Applications
| Positive WB detected in | DU 145 cells, LNCaP cells, PC-3 cells |
| Positive IP detected in | DU 145 cells |
| Positive IHC detected in | human testis tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse testis tissue |
| Positive IF/ICC detected in | PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IHC | See 3 publications below |
| IF | See 20 publications below |
Product Information
14040-1-AP targets ACRV1 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | mouse, rat, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5109 Product name: Recombinant human ACRV1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-265 aa of BC014588 Sequence: MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI 相同性解析による交差性が予測される生物種 |
| Full Name | acrosomal vesicle protein 1 |
| Calculated molecular weight | 28 kDa |
| Observed molecular weight | 13-36 kDa |
| GenBank accession number | BC014588 |
| Gene Symbol | ACRV1 |
| Gene ID (NCBI) | 56 |
| RRID | AB_10640426 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P26436 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The protein ACRV1, also known as SP-10, is an acrosomal matrix protein, which is evolutionarily conserved among mammals. It is associated with the matrix of the acrosomal vesicle in developing spermatids and the acrosomal matrix and membranes of ejaculated sperm (PMID: 8288254). Human ACRV1 protein has 11 isoforms, and molecular weight ranges from 9 to 28 kDa. ACRV1 was predominantly located in round and elongated spermatids in the testis, indicating that ACRV1 may play an important role in mammalian spermatogenesis and may be a target of a contraceptive vaccine (PMID: 21488928; 8874713).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ACRV1 antibody 14040-1-AP | Download protocol |
| IHC protocol for ACRV1 antibody 14040-1-AP | Download protocol |
| IP protocol for ACRV1 antibody 14040-1-AP | Download protocol |
| WB protocol for ACRV1 antibody 14040-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun piRNA loading triggers MIWI translocation from the intermitochondrial cement to chromatoid body during mouse spermatogenesis | ||
Nat Commun TDRD5 binds piRNA precursors and selectively enhances pachytene piRNA processing in mice. | ||
Nat Commun SYPL1 defines a vesicular pathway essential for sperm cytoplasmic droplet formation and male fertility | ||
Nucleic Acids Res Mitochondrial membrane-based initial separation of MIWI and MILI functions during pachytene piRNA biogenesis. | ||
Environ Sci Technol Screening and Evaluation of Male Reproductive Effects of Isothiazolinones at Human-Relevant Levels in Mammals: Direct Impairments and Increased Susceptibility to Subsequent Spermatogenic Stress | ||
Arch Toxicol Extended exposure to tetrabromobisphenol A-bis(2,3-dibromopropyl ether) leads to subfertility in male mice at the late reproductive age |








