Recombinant human Integrin beta-5 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag29783
Synonyms
ITGB5, Integrin beta 5, Integrin beta-5, integrin, beta 5
Validation Data Gallery
Product Information
| Peptide Sequence |
GLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTF
(24-126 aa encoded by BC006541) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
