Recombinant human PAX7 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag19171
Synonyms
FLJ37460; HUP1; PAX7B
Validation Data Gallery View All
Product Information
| Peptide Sequence |
YGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQFT
(463-518 aa encoded by BC121165) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |





