Recombinant human PDE5A protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag18779
Synonyms
CGB-PDE; CN5A; PDE5; PDE5A1
Validation Data Gallery View All
Product Information
| Peptide Sequence |
ETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTREHDANKINYMYAQYVKNTMEPLNIPDVSKDKRFPWTTENTGNVNQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEENTGKVK
(321-482 aa encoded by BC126233) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |

