CYP51A1 Recombinant monoclonal antibody, PBS Only (Capture)

CYP51A1 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 84705-2-PBS
Clone No.242166D6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

CP51, CYP51, CYPL1, CYPLI, Cytochrome P450 14DM

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration:  100 μg, 1 mg/ml
100 μg, 1 mg/ml

$699/ 100 μg

In stock at manufacturing site. Delivery in 3-4 weeks.

Freight/Packing: $40.00

Quantity

Product Information

84705-2-PBS targets CYP51A1 as part of a matched antibody pair:

MP01526-1: 84705-2-PBS capture and 84705-1-PBS detection (validated in Cytometric bead array)

MP01526-2: 84705-2-PBS capture and 84705-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4235

Product name: Recombinant human CYP51A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 146-509 aa of BC032322

Sequence: GKGVAYDVPNPVFLEQKKMLKSGLNIAHFKQHVSIIEKETKEYFESWGESGEKNVFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHREIKDIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQKKCYLEQKTVCGENLPPLTYDQLKDLNLLDRCIKETLRLRPPVMIMMRMARTPQTVAGYTIPPGHQVCVSPTVNQRLKDSWVERLDFNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFPTVNYTTMIHTPENPVIRYKRRSK

Predict reactive species
Full Name cytochrome P450, family 51, subfamily A, polypeptide 1
Calculated Molecular Weight 509 aa, 57 kDa
GenBank Accession NumberBC032322
Gene Symbol CYP51A1
Gene ID (NCBI) 1595
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16850
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...