Validation Data Gallery
Tested Applications
Positive WB detected in | HeLa cells, HAP1, K-562 cells, Neuro-2a cells, C6 cells |
Positive IP detected in | HAP1 cells, HeLa cells |
Positive IHC-Autostainer detected in | human brain tissue |
Positive IHC detected in | mouse brain tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | rat brain tissue |
Positive IF/ICC detected in | HeLa cells, HepG2 cells, SH-SY5Y cells, HAP1 cells |
Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC)-AUTOSTAINER | IHC-AUTOSTAINER : 1:50-1:500 |
Immunohistochemistry (IHC) | IHC : 1:1600-1:6400 |
Immunofluorescence (IF)-P | IF-P : 1:800-1:3200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 3 publications below |
IHC | See 1 publications below |
IF | See 3 publications below |
IP | See 1 publications below |
Product Information
80002-1-RR targets TDP-43 (N-terminal) in WB, IHC, IHC-Autostainer, IF/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag1231 Product name: Recombinant human TDP-43 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-260 aa of BC001487 Sequence: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA 相同性解析による交差性が予測される生物種 |
Full Name | TAR DNA binding protein |
Calculated molecular weight | 43 kDa |
Observed molecular weight | 43 kDa |
GenBank accession number | BC001487 |
Gene Symbol | TDP-43 |
Gene ID (NCBI) | 23435 |
RRID | AB_2882934 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q13148 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The TARDBP gene encodes the TDP-43 protein, initially found to repress HIV-1 transcription by binding TAR DNA. TDP-43 has since been shown to bind RNA as well as DNA, and have multiple functions in transcriptional repression, translational regulation and pre-mRNA splicing. For instance, it is reported to regulate alternate splicing of the CTFR gene.
In 2006 Neumann et al. found that hyperphosphorylated, ubiquitinated and/or cleaved forms of TDP-43, collectively known as pathological TDP-43, play a major role in the disease mechanisms of ubiquitin-positive, tau- and alpha-synuclein-negative frontotemporal dementia (FTLD-U) and in amyotrophic lateral sclerosis (ALS).
Proteintech's 80002-1-RR is a rabbit recombinant TDP-43 antibody recognizing N-terminal TDP-43. It recognizes the intact 43 kDa protein as well as all posttranslationally modified and truncated forms in multiple applications. Various forms of TDP-43 exist, including 18-35 kDa of cleaved C-terminal fragments, 45-50 kDa phospho-protein, 55 kDa glycosylated form, 75 kDa hyperphosphorylated form, and 90-300 kDa cross-linked form. (PMID: 17023659, 19823856, 21666678, 22193176)
Recently TDP-43 has been reported to be overexpressed in triple negative breast cancer (TNBC) and it may be a potential target for TNBC diagnosis and drug design. (PMID: 29581274)
80002-1-RR antibody works well in IF experiment.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TDP-43 (N-terminal) antibody 80002-1-RR | Download protocol |
IHC protocol for TDP-43 (N-terminal) antibody 80002-1-RR | Download protocol |
IF protocol for TDP-43 (N-terminal) antibody 80002-1-RR | Download protocol |
IP protocol for TDP-43 (N-terminal) antibody 80002-1-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
bioRxiv Patient-derived Induced Pluripotent Stem Cells as a Model to Study Frontotemporal Dementia Pathologies | ||
Nat Chem Biol Small-molecule dissolution of stress granules by redox modulation benefits ALS models | ||
Neural Regen Res 5-Hydroxytryptamine: a potential therapeutic target in amyotrophic lateral sclerosis | ||
F1000Res The identification of high-performing antibodies for TDP-43 for use in Western Blot, immunoprecipitation and immunofluorescence | ||