Validation Data Gallery
Tested Applications
| Positive WB detected in | pig colon tissue, human placenta tissue, human rectum tissue, rabbit large intestine tissue, rat colon tissue |
| Positive IHC detected in | human ovary tumor tissue, human hepatocirrhosis tissue, human placenta tissue, mouse skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human colon cancer tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 10 publications below |
| IHC | See 4 publications below |
| IF | See 1 publications below |
Product Information
68320-1-Ig targets Collagen Type III in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4229 Product name: Recombinant human COL3A1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1150-1466 aa of BC028178 Sequence: DGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLNVPRKHWWTDSSAEKKHVWFGESMDGGFQFSYGNPELPEDVLDVQLAFLRLLSSRASQNITYHCKNSIAYMDQASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLPIVDIAPYDIGGPDQEFGVDVGPVCFL 相同性解析による交差性が予測される生物種 |
| Full Name | collagen, type III, alpha 1 |
| Calculated molecular weight | 1466 aa, 139 kDa |
| Observed molecular weight | 130 kDa |
| GenBank accession number | BC028178 |
| Gene Symbol | COL3A1 |
| Gene ID (NCBI) | 1281 |
| RRID | AB_2935393 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P02461 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Type III collagen is a fibrillar-forming collagen comprising three α1(III) chains and is expressed in early embryos and throughout embryogenesis (PMID: 9050868). In the adult, type III collagen is a major component of the extracellular matrix in a variety of internal organs and skin. It occurs in most soft connective tissues along with type I collagen (PMID: 2445760). COL3A1 gene encodes type III procollagen. Mutations in this gene are associated with Ehlers-Danlos syndrome type IV, and with aortic and arterial aneurysms (PMID: 10706896; 2243125; 18389341).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Collagen Type III antibody 68320-1-Ig | Download protocol |
| IHC protocol for Collagen Type III antibody 68320-1-Ig | Download protocol |
| WB protocol for Collagen Type III antibody 68320-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Transl Med ITIH5-mediated fibroblast/macrophage crosstalk exacerbates cardiac remodelling after myocardial infarction | ||
Int J Mol Med SPP1 promotes the polarization of M2 macrophages through the Jak2/Stat3 signaling pathway and accelerates the progression of idiopathic pulmonary fibrosis | ||
J Nanobiotechnology NIR-II light based combinatorial management of hypertrophic scar by inducing autophagy in fibroblasts | ||
Cancer Biol Ther Role and mechanism of COL3A1 in regulating the growth, metastasis, and drug sensitivity in cisplatin-resistant non-small cell lung cancer cells
| ||
Biochem Biophys Res Commun The characterization of the sensitive ovarian cancer cell lines A2780 and W1 in response to ovarian CAFs | ||
J Ethnopharmacol Lichong Decoction Improves Inflammatory Microenvironment and Alleviates Fibrosis in Uterine Leiomyoma via Targeting CXCL8 |









