Validation Data Gallery
Tested Applications
| Positive WB detected in | HepG2 cells, HL-60 cells, HSC-T6 cells, NIH/3T3 cells, pig spleen tissue, rabbit spleen tissue, Jurkat cells, Raji cells, K-562 cells |
| Positive IHC detected in | human liver tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse liver tissue |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 57 publications below |
| IHC | See 12 publications below |
| IF | See 3 publications below |
| IP | See 1 publications below |
Product Information
67969-1-Ig targets MYD88 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27659 Product name: Recombinant human MYD88 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-296 aa of BC013589 Sequence: MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP 相同性解析による交差性が予測される生物種 |
| Full Name | myeloid differentiation primary response gene (88) |
| Calculated molecular weight | 33 kDa |
| Observed molecular weight | 33 kDa |
| GenBank accession number | BC013589 |
| Gene Symbol | MYD88 |
| Gene ID (NCBI) | 4615 |
| RRID | AB_2918720 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q99836 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
MYD88 is a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. MYD88 is the key adaptor protein for the interleukin-1 receptor (IL-1R) and most Toll-like receptors (TLRs), which are essential for innate immunity and pathogen-associated molecular pattern recognition. Mutations in the MyD88 gene lead to the development of cancer in humans and mice suggesting that MyD88 also plays a cell autonomous role in tissue homeostasis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MYD88 antibody 67969-1-Ig | Download protocol |
| IHC protocol for MYD88 antibody 67969-1-Ig | Download protocol |
| WB protocol for MYD88 antibody 67969-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Control Release Controlled extracellular vesicles release from aminoguanidine nanoparticle-loaded polylysine hydrogel for synergistic treatment of spinal cord injury | ||
Phytomedicine Rice bran active peptide (RBAP) inhibited macrophage differentiation to foam cell and atherosclerosis in mice via regulating cholesterol efflux | ||
Respir Res Bhlhe40 deficiency attenuates LPS-induced acute lung injury through preventing macrophage pyroptosis | ||
Inflammation Chlorogenic Acid Alleviates Hepatic Ischemia-Reperfusion Injury by Inhibiting Oxidative Stress, Inflammation, and Mitochondria-Mediated Apoptosis In Vivo and In Vitro | ||
Poult Sci Dietary chlorogenic acid enhances intestinal barrier function and modulates cecal microbiota in laying hens under H2O2-induced oxidative stress | ||
J Cell Mol Med P-Coumaric Acid Improves Skeletal Muscle Atrophy in Chronic Kidney Disease by Modulating TLR4/MyD88/NF-κB-Mediated Inflammation and Oxidative Stress |











