Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, A549 cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells |
| Positive IHC detected in | mouse brain tissue, human lung cancer tissue, human urothelial carcinoma tissue, human oesophagus cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse testis tissue |
| Positive FC (Intra) detected in | HEK-293 cells |
This antibody is not recommended for immunocytofluorescent assays.
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 11 publications below |
| WB | See 27 publications below |
| IHC | See 6 publications below |
| IF | See 9 publications below |
| IP | See 5 publications below |
| CoIP | See 1 publications below |
| RIP | See 3 publications below |
Product Information
67733-1-Ig targets METTL3 in WB, IHC, IF-P, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7110 Product name: Recombinant human METTL3 protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 229-580 aa of BC001650 Sequence: LNQQSTKEQQSKKVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGTKEECMKASDADRPCRKLHFRRIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPSQELALTQSVGGDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIPVLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGVKGNPQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL 相同性解析による交差性が予測される生物種 |
| Full Name | methyltransferase like 3 |
| Calculated molecular weight | 64 kDa |
| Observed molecular weight | 65-70 kDa |
| GenBank accession number | BC001650 |
| Gene Symbol | METTL3 |
| Gene ID (NCBI) | 56339 |
| RRID | AB_2918502 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q86U44 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
METTL3 is a key S-adenosyl-L-methionine-binding subunit, which is component of a complex multicomponent enzyme that catalyzes the methylation of internal adenosine residues in eukaryotic mRNA, forming N6-methyladenosine. It contains 2 putative nuclear localization signals and 2 consensus methylation motifs. The calculated molecular weight of METTL3 is 64 kDa, but modified METTL3 is about 65-70 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for METTL3 antibody 67733-1-Ig | Download protocol |
| IF protocol for METTL3 antibody 67733-1-Ig | Download protocol |
| IHC protocol for METTL3 antibody 67733-1-Ig | Download protocol |
| WB protocol for METTL3 antibody 67733-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Res METTL3 Methylation Induces Decay of Endogenous Retroelement Transcripts to Promote Tumor Immune Evasion.
| ||
Autophagy METTL3-dependent m6A modification of SNAP29 induces "autophagy-mitochondrial crisis" in the ischemic microenvironment after soft tissue transplantation | ||
Adv Sci (Weinh) Elevated Histone Lactylation Mediates Ferroptosis Resistance in Endometriosis Through the METTL3-Regulated HIF1A/HMOX1 Signaling Pathway | ||
Cell Death Dis Intracellular C5aR1 inhibits ferroptosis in glioblastoma through METTL3-dependent m6A methylation of GPX4
| ||
Cell Death Dis SALL4 promotes cancer stem-like cell phenotype and radioresistance in oral squamous cell carcinomas via methyltransferase-like 3-mediated m6A modification |


















