Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, pig liver tissue, NIH/3T3 cells, HSC-T6 cells, HepG2 cells, T-47D cells, L02 cells |
| Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 6 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
| IP | See 2 publications below |
| CoIP | See 2 publications below |
Product Information
66940-1-Ig targets RACK1; GNB2L1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig samples.
| Tested Reactivity | Human, Mouse, Rat, Pig |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26708 Product name: Recombinant human RACK1; GNB2L1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 131-317 aa of BC019093 Sequence: LWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQVTIGTR 相同性解析による交差性が予測される生物種 |
| Full Name | guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1 |
| Calculated molecular weight | 36 kDa |
| Observed molecular weight | 32 kDa |
| GenBank accession number | BC019093 |
| Gene Symbol | RACK1 |
| Gene ID (NCBI) | 10399 |
| RRID | AB_2882264 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P63244 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Members of the protein kinase C (PKC) family play a key regulatory role in a variety of cellular functions, including cell growth and differentiation, gene expression, hormone secretion and membrane function. RACK1 (receptor for activated protein kinase C 1), encoded by GNB2L1 gene, is a 317 amino acid guanine nucleotide-binding protein subunit beta-2-like 1 protein which is involved in the recruitment, assembly and/or regulation of a variety of signaling molecules, it contains 7 WD-repeats and is implicated in various protein interaction activities. RACK1 is a component of the 40S ribosomal subunit involved in translational repression. Recent finding suggests that RACK1 may be a new promising diagnosis biomarker and therapeutic target for non-small-cell lung cancer (NSCLC).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RACK1; GNB2L1 antibody 66940-1-Ig | Download protocol |
| IHC protocol for RACK1; GNB2L1 antibody 66940-1-Ig | Download protocol |
| WB protocol for RACK1; GNB2L1 antibody 66940-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Clin Invest CAP2 promotes gastric cancer metastasis by mediating the interaction between tumor cells and tumor-associated macrophages | ||
PNAS Nexus Ribosome stalling during c-myc translation presents actionable cancer cell vulnerability | ||
Inflamm Res The protective role of RACK1 in hepatic ischemia‒reperfusion injury-induced ferroptosis | ||
Cell Death Differ Loss of SMURF2 expression enhances RACK1 stability and promotes ovarian cancer progression | ||
J Virol VP3 protein of Senecavirus A promotes viral IRES-driven translation and attenuates innate immunity by specifically relocalizing hnRNPA2B1 | ||
J Med Chem Azoacetylene Electrophiles for Proteome-wide Ligand and Target Discovery: Supporting Targeted Protein Degradation |







