Validation Data Gallery
Tested Applications
| Positive WB detected in | MCF-7 cells, HeLa cells, Jurkat cells, HT-29 cells, L02 cells, A549 cells, MOLT-4 cells |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 51 publications below |
| IHC | See 8 publications below |
| IF | See 6 publications below |
| IP | See 1 publications below |
Product Information
66875-1-Ig targets SREBF1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, bovine |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5484 Product name: Recombinant human SREBF1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-332 aa of BC063281 Sequence: MDEPPFSEAALEQALGEPCDLDAALLTDIEGEVGAGRGRANGLDAPRAGADRGAMDCTFEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEK 相同性解析による交差性が予測される生物種 |
| Full Name | sterol regulatory element binding transcription factor 1 |
| Calculated molecular weight | 1177 aa, 125 kDa |
| Observed molecular weight | 125 kDa |
| GenBank accession number | BC063281 |
| Gene Symbol | SREBF1 |
| Gene ID (NCBI) | 6720 |
| RRID | AB_2882209 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P36956 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
SREBF1, also named as BHLHD1 and SREBP1, contains one basic helix-loop-helix (bHLH) domain and belongs to the SREBP family. It is a transcriptional activator required for lipid homeostasis. The SREBPs are synthesized as precursors anchored to endoplasmic reticulum (ER) membranes and complexed with SCAP. When the cellular cholesterol level is low, SREBP-SCAP complexes move to the Golgi apparatus, where SREBPs undergo a two-step proteolytic processing, leading to the release of the mature form, an N-terminal fragment, i.e, basic helix-loop-helix leucine zipper transcription factor. These factors enter the nucleus where they bind to sterol regulatory elements (SRE) in the promoter regions of a number of genes whose products mediate the synthesis of cholesterol and fatty acids. [PMID: 21698267]. This antibody can recognize the 125kd precursor form and the 68kd mature form of human SREBF1.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SREBF1 antibody 66875-1-Ig | Download protocol |
| IHC protocol for SREBF1 antibody 66875-1-Ig | Download protocol |
| WB protocol for SREBF1 antibody 66875-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab TMEM41B acts as an ER scramblase required for lipoprotein biogenesis and lipid homeostasis. | ||
J Hepatol OGDHL silencing promotes hepatocellular carcinoma by reprogramming glutamine metabolism. | ||
Nat Commun Pharmacological inhibition of Lin28 promotes ketogenesis and restores lipid homeostasis in models of non-alcoholic fatty liver disease | ||
Phytomedicine Asperosaponin VI protects alcohol-induced hepatic steatosis and injury via regulating lipid metabolism and ER stress | ||
Phytomedicine Wen-Shen-Jian-Pi-Hua-Tan decoction protects against early obesity-related glomerulopathy by improving renal bile acid composition and suppressing lipogenesis, inflammation, and fibrosis | ||
J Hazard Mater In vitro effects of Triclocarban on adipogenesis in murine preadipocyte and human hepatocyte. |








