Validation Data Gallery
Tested Applications
| Positive WB detected in | U2OS cells, HeLa cells, HEK-293 cells, 4T1 cells, HSC-T6 cells, NIH/3T3 cells, RAW 264.7 cells, MCF-7 cells, Jurkat cells, K-562 cells |
| Positive IHC detected in | human cervical cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 ul suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 46 publications below |
| IHC | See 2 publications below |
| IF | See 6 publications below |
Product Information
66563-1-Ig targets ATF6 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21456 Product name: Recombinant human ATF6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-194 aa of BC014969 Sequence: MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLVPWESDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQT 相同性解析による交差性が予測される生物種 |
| Full Name | activating transcription factor 6 |
| Calculated molecular weight | 75 kDa |
| Observed molecular weight | 90-100 kDa |
| GenBank accession number | BC014969 |
| Gene Symbol | ATF6 |
| Gene ID (NCBI) | 22926 |
| RRID | AB_2881924 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P18850 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Activating transcription factor 6 (ATF6) is a transcription factor that acts during endoplasmic reticulum stress by activating unfolded protein response target genes. ATF6 is the common name for this protein, sometimes also called ATF6A, to distinguish it from the paralogous gene ATF6B. The genes for ATF6A and ATF6B are located on different chromosomes. Binds DNA on the 5'-CCAC[GA]-3'half of the ER stress response element (ERSE) (5'-CCAAT-N(9)-CCAC[GA]-3') and of ERSE II (5'-ATTGG-N-CCACG-3'). Binding to ERSE requires binding of NF-Y to ERSE. Could also be involved in activation of transcription by the serum response factor.During unfolded protein response an approximative 50 kDa fragment containing the cytoplasmic transcription factor domain is released by proteolysis. The cleavage seems to be performed sequentially by site-1 and site-2 proteases. The fully glycosylated form of ATF6, a 670 amino acid protein, exhibits an electrophoretic mobility of ~90 kDa in denaturing SDS-gels, in part because of the glycosylated modifications. ATF6 has 3 consensus sites for N-linked glycosylation and exists constitutively as a glycosylated protein. Differentially glycosylated ATF6 forms may result from mutations or experimental treatment (PMID:15804611) (PMID:14699159). The antibody recognizes cleaved and fully glycosylated forms of ATF6.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for ATF6 antibody 66563-1-Ig | Download protocol |
| IF protocol for ATF6 antibody 66563-1-Ig | Download protocol |
| IHC protocol for ATF6 antibody 66563-1-Ig | Download protocol |
| WB protocol for ATF6 antibody 66563-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Protein Cell POST1/C12ORF49 regulates the SREBP pathway by promoting site-1 protease maturation. | ||
Nat Commun A small molecule VDAC ligand inhibits ERAD and induces selective cancer cell death via disruption of calcium homeostasis. | ||
Nat Commun Natural photosynthetic system for restoring homeostasis of animal organelle interaction network. | ||
Nat Commun OSGEP regulates islet β-cell function by modulating proinsulin translation and maintaining ER stress homeostasis in mice | ||
J Adv Res Impaired stemness in aging periodontal ligament stem cells is mediated by the progerin/endoplasmic reticulum stress/p53 axis | ||
J Adv Res Endothelial cells secrete small extracellular vesicles to promote neuron endoplasmic reticulum stress injury via miR-146a-5p/Eif4g2 axis in ischemic stroke |