Validation Data Gallery
Tested Applications
| Positive WB detected in | Saos-2 cells, MCF-7 cells, T-47D cells, HepG2 cells |
| Positive IHC detected in | human liver cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 7 publications below |
| IHC | See 3 publications below |
| IF | See 3 publications below |
Product Information
66534-1-Ig targets Cathepsin D in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15254 Product name: Recombinant human Cathepsin D protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 59-412 aa of BC016320 Sequence: VPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL 相同性解析による交差性が予測される生物種 |
| Full Name | cathepsin D |
| Calculated molecular weight | 412 aa, 45 kDa |
| Observed molecular weight | 32 kDa, 48 kDa, 52 kDa |
| GenBank accession number | BC016320 |
| Gene Symbol | Cathepsin D |
| Gene ID (NCBI) | 1509 |
| RRID | AB_2881897 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P07339 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
CTSD (Cathepsin D) also named CPSD, belongs to the peptidase A1 family. It is ubiquitously expressed and is involved in proteolytic degradation, cell invasion, and apoptosis. Human CTSD is synthesized as a 52-kDa precursor that is converted into an active 48-kDa single-chain intermediate in the endosomes, and then into a fully active mature form, composed of a 34-kDa heavy chain and a 14-kDa light chain, in the lysosomes. It is a lysosomal acid protease found in neutrophils and monocytes and involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease (PMID: 27114232, PMID: 30717773, PMID: 30051532).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Cathepsin D antibody 66534-1-Ig | Download protocol |
| IF protocol for Cathepsin D antibody 66534-1-Ig | Download protocol |
| IHC protocol for Cathepsin D antibody 66534-1-Ig | Download protocol |
| WB protocol for Cathepsin D antibody 66534-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Gastroenterology Proteomic characterization identifies clinically relevant subgroups of gastrointestinal stromal tumors | ||
Life (Basel) Melibiose Confers a Neuroprotection against Cerebral Ischemia/Reperfusion Injury by Ameliorating Autophagy Flux via Facilitation of TFEB Nuclear Translocation in Neurons. | ||
Cell Rep Intracellular complement C5a/C5aR1 stabilizes β-catenin to promote colorectal tumorigenesis.
| ||
Neurochem Int Impaired lysosomal proteolysis in developing neurons induces protein aggregation and disrupts morphogenesis and neuromaturation | ||
Neural Regen Res Pathological axonal enlargement in connection with amyloidosis, lysosome destabilization, and bleeding is a major defect in Alzheimer's disease | ||
Front Pharmacol Scutellarin ameliorates ischemia/reperfusion-mediated endothelial dysfunction by upregulating cathepsin D expression to rescue autophagy-lysosomal function |










