Validation Data Gallery
Tested Applications
Positive WB detected in | A549 cells, LPS treated U-937 cells, HEK-293 cells, Raji cells, Jurkat cells, NCI-H1299 cells |
Positive IHC detected in | human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 13 publications below |
IHC | See 1 publications below |
IF | See 3 publications below |
IP | See 3 publications below |
CoIP | See 1 publications below |
Product Information
66310-1-Ig targets TRAF3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag12185 Product name: Recombinant human TRAF3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 6-351 aa of BC075087 Sequence: KMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMK 相同性解析による交差性が予測される生物種 |
Full Name | TNF receptor-associated factor 3 |
Calculated molecular weight | 568 aa, 64 kDa |
Observed molecular weight | 64 kDa |
GenBank accession number | BC075087 |
Gene Symbol | TRAF3 |
Gene ID (NCBI) | 7187 |
RRID | AB_2881692 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q13114 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
TNF receptor-associated factor 3 (TRAF3) has many alternative names including CAP-1, CD40 receptor-associated factor 1(CRAF1), CD40-binding protein(CD40BP) and LMP1-associated protein 1 (LAP1). TRAF3 regulates pathways leading to the activation of NF-kappa-B and MAP kinases, and plays a central role in the regulation of innate immune response. It modulates signaling pathways leading to the production of cytokines and interferon. As an essential constituent of several E3 ubiquitin-protein ligase complexes, TRAF3 promote 'Lys-63'-linked ubiquitination of target proteins. Moreover, TRAF3 undergoes both 'Lys-48'-linked and 'Lys-63'-linked ubiquitination in response to various stimuli and is deubiquitinated by OTUB1, OTUB2 and OTUD5.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TRAF3 antibody 66310-1-Ig | Download protocol |
IHC protocol for TRAF3 antibody 66310-1-Ig | Download protocol |
IF protocol for TRAF3 antibody 66310-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Am J Obstet Gynecol microRNA-322 overexpression reduces neural tube defects in diabetic pregnancies | ||
Clin Transl Med Hypoxic colorectal cancer-derived extracellular vesicles deliver microRNA-361-3p to facilitate cell proliferation by targeting TRAF3 via the noncanonical NF-κB pathways. | ||
mBio ASB3 expression aggravates inflammatory bowel disease by targeting TRAF6 protein stability and affecting the intestinal microbiota | ||
Free Radic Biol Med Virtual screening identified natural Keap1-Nrf2 PPI inhibitor alleviates inflammatory osteoporosis through Nrf2-mir214-Traf3 axis. | ||
Front Immunol Swine Acute Diarrhea Syndrome Coronavirus Nucleocapsid Protein Antagonizes Interferon-β Production via Blocking the Interaction Between TRAF3 and TBK1. | ||
Bioorg Chem Synthesis and anti-inflammatory activity of paeonol derivatives with etherized aryl urea by regulating TLR4/MyD88 signaling pathway in RAW264.7 cell. |