Product Information
66050-1-PBS targets NDUFA4L2 as part of a matched antibody pair:
MP50529-1: 66050-1-PBS capture and 66050-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag9233 Product name: Recombinant human NDUFA4L2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-87 aa of BC011910 Sequence: MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF Predict reactive species |
Full Name | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4-like 2 |
Calculated Molecular Weight | 87 aa, 10 kDa |
Observed Molecular Weight | 10 kDa |
GenBank Accession Number | BC011910 |
Gene Symbol | NDUFA4L2 |
Gene ID (NCBI) | 56901 |
RRID | AB_11045656 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q9NRX3 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
NDUFA4L2, also named as NUOMS, is a HIF-1α target gene that localizes to the mitochondria. It downregulates oxygen consumption and Complex I activity in hypoxia. NDUFA4L2 is involved in hypoxic adaptation by decreasing mitochondrial ROS production.