Validation Data Gallery
Tested Applications
Positive WB detected in | HeLa cells, A431 cells, A549 cells, Jurkat cells, Raji cells, Ramos cells, Daudi cells |
Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells, MCF-7 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 19 publications below |
IHC | See 1 publications below |
IP | See 1 publications below |
CoIP | See 1 publications below |
Product Information
66026-1-Ig targets MCL1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse, rat, hamster |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag10609 Product name: Recombinant human MCL1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-327 aa of BC107735 Sequence: MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGG 相同性解析による交差性が予測される生物種 |
Full Name | myeloid cell leukemia sequence 1 (BCL2-related) |
Calculated molecular weight | 350 aa, 37 kDa |
GenBank accession number | BC107735 |
Gene Symbol | MCL1 |
Gene ID (NCBI) | 4170 |
RRID | AB_11041711 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q07820 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
MCL-1 is an anti-apoptotic member of the Bcl-2 family originally isolated from the ML-1 human myeloid leukemia cell line. Similar to BCL2 and BCL2L1, MCL1 can interact with BAX and/or BAK1 to inhibit mitochondria-mediated apoptosis. Mcl-1 is critical for the proliferation and survival of myeloma cells in vitro, and overexpression of Mcl-1 protein in myeloma cells is associated with relapse and short event-free survival in multiple myeloma patients. Recent studies show that MCL-1 is upregulated in numerous haematological and solid tumour malignancies. Therefore, MCL-1 has been suggested as a potential new therapeutic target.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MCL1 antibody 66026-1-Ig | Download protocol |
IHC protocol for MCL1 antibody 66026-1-Ig | Download protocol |
IF protocol for MCL1 antibody 66026-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Int J Mol Sci Intermittent Fasting Aggravates Lupus Nephritis through Increasing Survival and Autophagy of Antibody Secreting Cells in MRL/lpr Mice. | ||
Biochim Biophys Acta Mol Basis Dis Extracellular ATP (eATP) inhibits the progression of endometriosis and enhances the immune function of macrophages | ||
Epigenetics Decreased DHRS2 expression is associated with HDACi resistance and poor prognosis in ovarian cancer. | ||
J Nat Prod Hernandezine Regulates Proliferation and Autophagy-Induced Apoptosis in Melanoma Cells. | ||
Mol Microbiol The emerging oral pathogen, Filifactor alocis, extends the functional lifespan of human neutrophils. | ||
Ann Transl Med Adipose-derived stem cells (ADSCs) inhibit the expression of anti-apoptosis proteins through up-regulation of ATF4 on breast cancer cells. |