Validation Data Gallery
Tested Applications
| Positive WB detected in | MCF-7 cells, HeLa cells, HEK-293 cells, HepG2 cells, LNCaP cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 10 publications below |
| WB | See 85 publications below |
| IHC | See 19 publications below |
| IF | See 12 publications below |
| IP | See 4 publications below |
| RIP | See 3 publications below |
Product Information
60188-1-Ig targets WTAP in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, drosophila |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0259 Product name: Recombinant human WTAP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2-150 aa of BC000383 Sequence: TNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPD 相同性解析による交差性が予測される生物種 |
| Full Name | Wilms tumor 1 associated protein |
| Calculated molecular weight | 45 kDa |
| Observed molecular weight | 50 kDa |
| GenBank accession number | BC000383 |
| Gene Symbol | WTAP |
| Gene ID (NCBI) | 9589 |
| RRID | AB_10859484 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q15007 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
WTAP, also named as KIAA0105 and hFL(2)D, is previously identified as a protein associated with Wilms' tumor-1 (WT-1) protein that is essential for the development of the genitourinary system. It is a Pre-mRNA-splicing regulator protein. It is a regulatory subunit of the WMM N6-methyltransferase complex which plays a role in the efficiency of mRNA splicing and processing and mRNA stability. It is required for accumulation of METTL3 and METTL14 to nuclear speckle. MW of WTAP is 45-50 kDa due to phosphorylation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for WTAP antibody 60188-1-Ig | Download protocol |
| IHC protocol for WTAP antibody 60188-1-Ig | Download protocol |
| IP protocol for WTAP antibody 60188-1-Ig | Download protocol |
| WB protocol for WTAP antibody 60188-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Science Stem cells. m6A mRNA methylation facilitates resolution of naïve pluripotency toward differentiation. | ||
Nat Cell Biol Redox regulation of m6A methyltransferase METTL3 in β-cells controls the innate immune response in type 1 diabetes | ||
Cell Res Oncogenic AURKA-enhanced N6-methyladenosine modification increases DROSHA mRNA stability to transactivate STC1 in breast cancer stem-like cells. | ||
Nat Neurosci Synaptic N6-methyladenosine (m6A) epitranscriptome reveals functional partitioning of localized transcripts. | ||
Mol Cell Altered m6A Modification of Specific Cellular Transcripts Affects Flaviviridae Infection. |





