Validation Data Gallery
Tested Applications
| Positive WB detected in | A431 cells, HEK-293 cells, NIH/3T3 cells, HepG2 cells, Jurkat cells, SH-SY5Y cells, COS-7 cells, HeLa cells, MCF-7 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human stomach tissue, human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:750-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 6 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
22142-1-AP targets RCC1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, monkey samples.
| Tested Reactivity | human, mouse, monkey |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17569 Product name: Recombinant human RCC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 72-421 aa of BC010067 Sequence: AEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS 相同性解析による交差性が予測される生物種 |
| Full Name | regulator of chromosome condensation 1 |
| Calculated molecular weight | 421 aa, 45 kDa |
| Observed molecular weight | 45-50 kDa |
| GenBank accession number | BC010067 |
| Gene Symbol | RCC1 |
| Gene ID (NCBI) | 1104 |
| RRID | AB_11183045 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P18754 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
CHC1, also named as RCC1, promotes the exchange of ran-bound gdp by gtp. It is involved in the regulation of onset of chromosome condensation in the S-phase. Phosphorylation of RCC1 on serines located in or near its nuclear localization signal activates RCC1 to generate RanGTP on mitotic chromosomes, which is required for spindle assembly and chromosome segregation. This antibody is a rabbit polyclonal antibody raised against residues near the C terminus of human RCC1.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RCC1 antibody 22142-1-AP | Download protocol |
| IHC protocol for RCC1 antibody 22142-1-AP | Download protocol |
| IP protocol for RCC1 antibody 22142-1-AP | Download protocol |
| WB protocol for RCC1 antibody 22142-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Curr Biol Differences in Mitotic Spindle Architecture in Mammalian Neural Stem Cells Influence Mitotic Accuracy during Brain Development. | ||
Biomaterials Combination antitumor immunotherapy with VEGF and PIGF siRNA via systemic delivery of multi-functionalized nanoparticles to tumor-associated macrophages and breast cancer cells. | ||
J Med Chem Selective Peptidomimetic Inhibitors of NTMT1/2: Rational Design, Synthesis, Characterization, and Crystallographic Studies. | ||
Cell Death Dis Regulator of chromatin condensation 1 abrogates the G1 cell cycle checkpoint via Cdk1 in human papillomavirus E7-expressing epithelium and cervical cancer cells. | ||
J Cell Mol Med SNORA73B promotes endometrial cancer progression through targeting MIB1 and regulating host gene RCC1 alternative splicing |








