Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse kidney tissue, human skeletal muscle tissue | 
| Positive IP detected in | mouse kidney tissue | 
| Positive IHC detected in | human kidney tissue, mouse testis tissue,  human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
| Positive IF-P detected in | human kidney tissue, mouse kidney tissue | 
| Positive IF-Fro detected in | mouse kidney tissue | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:500-1:1000 | 
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 | 
| Immunofluorescence (IF)-FRO | IF-FRO : 1:200-1:800 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21115-1-AP targets ACE2 in WB, IHC, IF-P, IF-Fro, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat, canine, monkey | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag15455 Product name: Recombinant human ACE2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 392-744 aa of BC048094 Sequence: LRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVSIWLI相同性解析による交差性が予測される生物種 | 
| Full Name | angiotensin I converting enzyme (peptidyl-dipeptidase A) 2 | 
| Calculated molecular weight | 805 aa, 92 kDa | 
| Observed molecular weight | 120 kDa, 92 kDa | 
| GenBank accession number | BC048094 | 
| Gene Symbol | ACE2 | 
| Gene ID (NCBI) | 59272 | 
| RRID | AB_10732845 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q9BYF1 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
ACE2 (Angiotensin-converting enzyme 2), also named as ACEH, is a zinc metalloprotease of the ACE family and a critical regulator of the reninangiotensin system. ACE2 has a more restricted tissue distribution than ACE, being found predominantly in the heart, kidneys, and testes although low levels have been detected in a variety of tissues (PMID:15983030). ACE2 has been shown to be a functional receptor of the human coronaviruses SARS-CoV and SARS-CoV-2 (PMID: 32142651). The expression level and expression pattern of human ACE2 in different tissues might be critical for the susceptibility, symptoms, and outcome of 2019-nCoV/SARS-CoV-2 infection (PMID: 32133153). It can be used as a potential therapeutic target of SARS-CoV-2 (PMID: 32125455). The calculated molecular weight of ACE2 is 92kDa but it migrates to 120kDa due to N-glycosylation (PMID:16166094). Sometimes, several cleaved fragments can also be detected as 75kDa, 50 kDa or 37kDa (PMID: 29561187, 22009550, 30759273). It has 2 isoforms produced by alternative splicing. This antibody is specific to ACE2. The location of ACE2 is membrane and cytoplasm, however it accumulates in the nucleus during the mitosis (PMID: 1730413/PMID: 18292088).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ACE2 antibody 21115-1-AP | Download protocol | 
| IHC protocol for ACE2 antibody 21115-1-AP | Download protocol | 
| IP protocol for ACE2 antibody 21115-1-AP | Download protocol | 
| WB protocol for ACE2 antibody 21115-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| Nat Genet Bidirectional genome-wide CRISPR screens reveal host factors regulating SARS-CoV-2, MERS-CoV and seasonal HCoVs | ||
| Cell Stem Cell Androgen Signaling Regulates SARS-CoV-2 Receptor Levels and Is Associated with Severe COVID-19 Symptoms in Men. | ||
| Cell Res Receptome profiling identifies KREMEN1 and ASGR1 as alternative functional receptors of SARS-CoV-2. | ||
| Nat Neurosci Olfactory transmucosal SARS-CoV-2 invasion as a port of central nervous system entry in individuals with COVID-19. | ||
| Nat Commun Evolution of Omicron lineage towards increased fitness in the upper respiratory tract in the absence of severe lung pathology | ||
















