Validation Data Gallery
Tested Applications
| Positive WB detected in | human kidney tissue, HEK-293 cells, HepG2 cells |
| Positive IHC detected in | human kidney tissue, human endometrial cancer tissue, human lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human kidney tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 13 publications below |
| IF | See 6 publications below |
Product Information
18150-1-AP targets Podocalyxin in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12844 Product name: Recombinant human TRA-1-60 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 23-428 aa of BC093730 Sequence: SPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLPSSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRFSM 相同性解析による交差性が予測される生物種 |
| Full Name | podocalyxin-like |
| Calculated molecular weight | 526 aa, 55 kDa |
| Observed molecular weight | 60-70 kDa |
| GenBank accession number | BC093730 |
| Gene Symbol | Podocalyxin |
| Gene ID (NCBI) | 5420 |
| RRID | AB_11044193 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00592 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Podocalyxin, also known as podocalyxin-like protein 1 (PODXL or PCLP1), is a transmembrane glycoprotein belonging to the CD34 family of sialomucins. Podocalyxin was originally identified as the major sialoprotein on podocytes of the kidney glomerulus but was later found to be expressed on vascular endothelial cells and early hematopoietic progenitors. It is involved in the regulation of both adhesion and cell morphology. In addition, podocalyxin is highly expressed in embryonic stem cells and aberrant expression of podocalyxin has been implicated in a wide range of cancers. Podocalyxin is a protein with a peptide bone of ∼55.5 kDa that undergoes a post‐translational glycosylation, the different molecular mass of podocalyxin indicates the extent and variability of glycosylation patterns (PMID: 17092254).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Podocalyxin antibody 18150-1-AP | Download protocol |
| IHC protocol for Podocalyxin antibody 18150-1-AP | Download protocol |
| WB protocol for Podocalyxin antibody 18150-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Kidney Int Quantitative assessment of glomerular basement membrane collagen IV α chains in paraffin sections from patients with focal segmental glomerulosclerosis and Alport gene variants | ||
Kidney Int Non-canonical Wnt/calcium signaling is protective against podocyte injury and glomerulosclerosis | ||
Nat Commun The V-ATPase/ATG16L1 axis drives membrane remodeling during epithelial morphogenesis. | ||
Sci Adv Single-cell and high-resolution spatial profiling of podocytopathies reveals core mechanisms of podocyte injury. | ||
Cell Commun Signal Podocalyxin and ciliary neurotrophic factor receptor are novel components of the surfaceome of chondrogenic cells. | ||
Cell Genom The extracellular vesicle transcriptome provides tissue-specific functional genomic annotation relevant to disease susceptibility in obesity. |