Validation Data Gallery
Tested Applications
| Positive WB detected in | DU 145 cells, HCT 116 cells, BxPC-3 cells, human lung tissue, HEK-293 cells, human heart tissue, COLO 320 cells, HaCaT cells, U2OS cells, SKOV-3 cells |
| Positive IP detected in | DU 145 cells, PC-3 cells |
| Positive IHC detected in | human breast cancer tissue, human cervical cancer tissue, human colon tissue, human colon cancer tissue, human liver cancer tissue, human lung cancer tissue, human ovary tumor tissue, human thyroid cancer tissue, mouse kidney tissue, rat kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PC-3 cells, BxPC-3 cells |
| Positive FC (Intra) detected in | PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 8 publications below |
| WB | See 41 publications below |
| IHC | See 17 publications below |
| IF | See 18 publications below |
| IP | See 1 publications below |
| CoIP | See 2 publications below |
Product Information
10237-1-AP targets S100A11 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, Neutralization, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0343 Product name: Recombinant human S100A11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 4-105 aa of BC001410 Sequence: ISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT 相同性解析による交差性が予測される生物種 |
| Full Name | S100 calcium binding protein A11 |
| Calculated molecular weight | 105 aa, 12 kDa |
| Observed molecular weight | 12 kDa |
| GenBank accession number | BC001410 |
| Gene Symbol | S100A11 |
| Gene ID (NCBI) | 6282 |
| RRID | AB_2183478 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P31949 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
S100A11 (also known as S100C or calziggarin), is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs (PMID: 18694925). S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. First discovered in 1989, S100A11 has since been proposed to have direct biological functions in an assortment of physiological processes such as endo- and exocytosis, regulation of enzyme activity, cell growth and regulation, apoptosis and inflammation (PMID: 15241500). Chromosomal rearrangements and altered expression of S100A11 have been implicated in tumor metastasis. This S100A11 antibody (10237-1-AP) has also been instrumental in investigations into S100A11's role in the development of brain tumors in tuberous sclerosis complex (TSC) patients (PMID: 20133820).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for S100A11 antibody 10237-1-AP | Download protocol |
| IF protocol for S100A11 antibody 10237-1-AP | Download protocol |
| IHC protocol for S100A11 antibody 10237-1-AP | Download protocol |
| IP protocol for S100A11 antibody 10237-1-AP | Download protocol |
| WB protocol for S100A11 antibody 10237-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun S100A11 is required for efficient plasma membrane repair and survival of invasive cancer cells. | ||
Dev Cell Annexin A1 Tethers Membrane Contact Sites that Mediate ER to Endosome Cholesterol Transport. | ||
J Pathol Tissue-based proteomics reveals FXYD3, S100A11 and GSTM3 as novel markers for regional lymph node metastasis in colon cancer. | ||
Mol Cell Proteomics S100A11 mediates hypoxia-induced mitogenic factor (HIMF)-induced smooth muscle cell migration, vesicular exocytosis, and nuclear activation. | ||
Cell Mol Gastroenterol Hepatol S100A11 Promotes Liver Steatosis via FOXO1-Mediated Autophagy and Lipogenesis. | ||
J Clin Endocrinol Metab Down-regulation of S100A11, a calcium-binding protein, in human endometrium may cause reproductive failure. |





























