Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse kidney tissue, mouse skeletal muscle tissue, rat kidney tissue, rat skeletal muscle tissue |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 42 publications below |
| IHC | See 3 publications below |
| IF | See 4 publications below |
| IP | See 2 publications below |
Product Information
16006-1-AP targets CISD1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8680 Product name: Recombinant human mitoNEET,CISD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC007043 Sequence: MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET 相同性解析による交差性が予測される生物種 |
| Full Name | CDGSH iron sulfur domain 1 |
| Calculated molecular weight | 108 aa, 12 kDa |
| Observed molecular weight | 14-17 kDa |
| GenBank accession number | BC007043 |
| Gene Symbol | CISD1 |
| Gene ID (NCBI) | 55847 |
| RRID | AB_2080268 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NZ45 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
MitoNEET, also named CISD1, belongs to a previously uncharacterized ancient family of proteins for which the hallmark is the presence of a unique 39 amino acid CDGSH domain. It is a single-pass type III membrane protein, located in mitochondrion outer membrane and may play a role in regulating maximal capacity for electron transport and oxidative phosphorylation. MitoNEET is a recently identified drug target for a commonly prescribed diabetes drug, Pioglitazone. This antibody recognizing MitoNEET (calculated 12 kDa) as a 17 kDa protein may be due to its posttranslational modification or metal binding activity.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CISD1 antibody 16006-1-AP | Download protocol |
| IHC protocol for CISD1 antibody 16006-1-AP | Download protocol |
| IP protocol for CISD1 antibody 16006-1-AP | Download protocol |
| WB protocol for CISD1 antibody 16006-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab Basal Mitophagy Occurs Independently of PINK1 in Mouse Tissues of High Metabolic Demand. | ||
Mol Cell Quantitative proteomics reveal a feedforward mechanism for mitochondrial PARKIN translocation and ubiquitin chain synthesis. | ||
Mol Cell Dynamics of PARKIN-Dependent Mitochondrial Ubiquitylation in Induced Neurons and Model Systems Revealed by Digital Snapshot Proteomics. | ||
Mol Cell Global Landscape and Dynamics of Parkin and USP30-Dependent Ubiquitylomes in iNeurons during Mitophagic Signaling. | ||
Sci Adv AMPK/ULK1-mediated phosphorylation of Parkin ACT domain mediates an early step in mitophagy. |
