Validation Data Gallery
Tested Applications
| Positive IHC detected in | rat brain tissue, mouse brain tissue, mouse pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat brain tissue, mouse brain tissue |
| Positive IF-Fro detected in | rat brain tissue |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 11 publications below |
| IHC | See 7 publications below |
| IF | See 13 publications below |
| IP | See 1 publications below |
| CoIP | See 2 publications below |
| ChIP | See 1 publications below |
Product Information
26995-1-AP targets WFS1 in WB, IHC, IF/ICC, IF-P, IF-Fro, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25724 Product name: Recombinant human WFS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC030130 Sequence: MDSNTAPLGPSCPQPPPAPQPQARSRLNATASLEQERSERPRAPGPQAGPGPGVRDAAAPAEPQAQHTRSRERADGTGPTKGDMEIPFEEVLERA 相同性解析による交差性が予測される生物種 |
| Full Name | Wolfram syndrome 1 (wolframin) |
| Calculated molecular weight | 890 aa, 100 kDa |
| Observed molecular weight | |
| GenBank accession number | BC030130 |
| Gene Symbol | WFS1 |
| Gene ID (NCBI) | 7466 |
| RRID | AB_2880717 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O76024 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Wolfram syndrome protein (WFS1), also called wolframin, is a transmembrane protein, which is located primarily in the endoplasmic reticulum and its expression is induced in response to ER stress, partially through transcriptional activation. ER localization suggests that WFS1 protein has physiological functions in membrane trafficking, secretion, processing and/or regulation of ER calcium homeostasis. It is ubiquitously expressed with highest levels in brain, pancreas, heart, and insulinoma beta-cell lines. Mutations of the WFS1 gene are responsible for two hereditary diseases, autosomal recessive Wolfram syndrome and autosomal dominant low frequency sensorineural hearing loss. Wolframin assembles into higher molecular weight complexes of approximately 400 kDa in the membrane(PMID: 12913071)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for WFS1 antibody 26995-1-AP | Download protocol |
| IHC protocol for WFS1 antibody 26995-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Sci Transl Med Wolframin-1-expressing neurons in the entorhinal cortex propagate tau to CA1 neurons and impair hippocampal memory in mice. | ||
Neuron Astrocyte-mediated regulation of BLAWFS1 neurons alleviates risk-assessment deficits in DISC1-N mice | ||
Nat Commun WFS1 functions in ER export of vesicular cargo proteins in pancreatic β-cells.
| ||
Prog Neurobiol The fasciola cinereum subregion of the hippocampus is important for the acquisition of visual contextual memory. | ||
Cell Rep Acetylcholine synergizes with netrin-1 to drive persistent firing in the entorhinal cortex |

















