Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, rat skeletal muscle tissue, mouse skeletal muscle, Jurkat cells, U-87 cells | 
| Positive IP detected in | mouse skeletal muscle tissue | 
| Positive IHC detected in | human colon tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:150-1:600 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 5 publications below | 
| WB | See 10 publications below | 
| IHC | See 1 publications below | 
Product Information
13676-1-AP targets WDR1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag4670 Product name: Recombinant human WDR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC030541 Sequence: MPYEIKKVFASLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDDHSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVSVNSVVSTFPMGSTVLDQQLGCLWQKDHLLSVSLSGYINYLDRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILGTTLKDEGKLLEAKG相同性解析による交差性が予測される生物種 | 
| Full Name | WD repeat domain 1 | 
| Calculated molecular weight | 606 aa, 66 kDa | 
| Observed molecular weight | 66-70 kDa | 
| GenBank accession number | BC030541 | 
| Gene Symbol | WDR1 | 
| Gene ID (NCBI) | 9948 | 
| RRID | AB_10697831 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | O75083 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
WDR1, which belongs to the WD repeat AIP1 family, also known as AIP1, is a 606 amino acid protein that localizes to the cytoskeleton. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, mostly including a trp-asp at the C-terminal end. WDR1 induces the disassembly of actin filaments in conjunction with ADF/cofilin family proteins (PMID:15629458, 27557945, 29751004). WDR1 mutations may impair the ability of WDR1 to regulate cofilin-mediated actin depolymerization, and are associated with periodic fever, immunodeficiency, and thrombocytopenia syndrome (PMID: 27557945,27994071,29751004).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for WDR1 antibody 13676-1-AP | Download protocol | 
| IP protocol for WDR1 antibody 13676-1-AP | Download protocol | 
| WB protocol for WDR1 antibody 13676-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| Cell Death Dis AIP1-mediated actin disassembly is required for postnatal germ cell migration and spermatogonial stem cell niche establishment. | ||
| J Biol Chem Trp-Asp (WD) repeat domain 1 is Essential for Mouse Peri-implantation Development and Regulates Cofilin Phosphorylation. | ||
| Am J Pathol A Cardiomyocyte-Specific Wdr1 Knockout Demonstrates Essential Functional Roles for Actin Disassembly during Myocardial Growth and Maintenance In Mice.
 | ||
| Mol Cells WD Repeat Domain 1 Deficiency Inhibits Neointima Formation in Mice Carotid Artery by Modulation of Smooth Muscle Cell Migration and Proliferation.
 | ||
| Int J Biol Sci WDR1 Promotes Cell Growth and Migration and Contributes to Malignant Phenotypes of Non-small Cell Lung Cancer through ADF/cofilin-mediated Actin Dynamics.
 | ||
| Dev Biol WDR1-regulated actin dynamics is required for outflow tract and right ventricle development.
 | 







