Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse brain tissue, HeLa cells, HepG2 cells, human brain tissue, mouse tongue tissue, rat brain tissue, mouse cerebellum tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | Human bowens disease Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IF | See 1 publications below |
Product Information
13919-1-AP targets VILIP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4923 Product name: Recombinant human VSNL1 protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 1-191 aa of BC022012 Sequence: MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK 相同性解析による交差性が予測される生物種 |
| Full Name | visinin-like 1 |
| Calculated molecular weight | 22 kDa |
| Observed molecular weight | 18-24 kDa |
| GenBank accession number | BC022012 |
| Gene Symbol | VSNL1 |
| Gene ID (NCBI) | 7447 |
| RRID | AB_2215851 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62760 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Visinin-like protein 1 (VILIP1) is also named VLP-1, hippocalcin-like protein 3 (HLP3), VSNL1 and VISL1. The neuronal calcium sensor protein VILIP1 forms a complex with neurotransmitter-gated P2X2 receptors, functions as a channel regulator, and likely binds more tightly to P2X2 receptors in an activation- and calcium-dependent manner (PMID: 18922787). VILIP1 is widely expressed and involved in physiological and disease processes throughout the body, including tumor formation (PMID: 17311005, PMID: 18301774). VILIP1 is localized primarily in the rat hippocampus, where it controls neuronal excitability important for learning and memory (PMID: 18440708, PMID: 15336574). In particular, VILIP1 binds to the α-subunit of the α4β2 nicotinic acetylcholine receptor (nAChR), which promotes its surface expression and trafficking in oocytes and hippocampal neurons (PMID: 1220248, PMID: 19063970).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for VILIP1 antibody 13919-1-AP | Download protocol |
| IHC protocol for VILIP1 antibody 13919-1-AP | Download protocol |
| IP protocol for VILIP1 antibody 13919-1-AP | Download protocol |
| WB protocol for VILIP1 antibody 13919-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Free Radic Biol Med Dimerization of visinin-like-protein 1 is regulated by oxidative stress and calcium and is a pathological hallmark of amyotrophic lateral sclerosis. | ||
Front Cell Neurosci Lack of Helios During Neural Development Induces Adult Schizophrenia-Like Behaviors Associated With Aberrant Levels of the TRIF-Recruiter Protein WDFY1. | ||
Signal Transduct Target Ther Visinin-like protein 1 disrupts calcium homeostasis and promotes atrial fibrillation in human and rodent models | ||
Sci Rep Proteomic profile of human sinoatrial and atrioventricular nodes in comparison to working myocardium |








