Validation Data Gallery
Tested Applications
Positive WB detected in | MCF-7 cells, HeLa cells, HSC-T6 cells, T-47D cells, NCCIT cells, COLO 320 cells, 4T1 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 17 publications below |
IHC | See 1 publications below |
IF | See 6 publications below |
ChIP | See 1 publications below |
Product Information
67192-1-Ig targets VDR in WB, IHC, IF, ChIP, ELISA applications and shows reactivity with Human, mouse, rat samples.
Tested Reactivity | Human, mouse, rat |
Cited Reactivity | human, mouse, rat, pig |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag28188 Product name: Recombinant human VDR protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 81-220 aa of BC060832 Sequence: LKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLE 相同性解析による交差性が予測される生物種 |
Full Name | vitamin D (1,25- dihydroxyvitamin D3) receptor |
Calculated molecular weight | 48 kDa |
Observed molecular weight | 48-55 kDa |
GenBank accession number | BC060832 |
Gene Symbol | VDR |
Gene ID (NCBI) | 7421 |
RRID | AB_2882487 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P11473 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The vitamin D receptor (VDR), also known as NR1I1 (nuclear receptor subfamily 1, group I, member 1), is a member of the nuclear receptor family of transcription factors. Upon activation by vitamin D, the VDR forms a heterodimer with the retinoid-X receptor and binds to hormone response elements on DNA resulting in expression or trans-repression of specific gene products.It is an intracellular hormone receptor that specifically binds 1,25(OH)2D3 and mediates its effects. Downstream targets of this nuclear hormone receptor are principally involved in mineral metabolism though the receptor regulates a variety of other metabolic pathways, such as those involved in the immune response and cancer. Defects in VDR are the cause of rickets vitamin D-dependent type 2A (VDDR2A). A disorder of vitamin D metabolism results in severe rickets, hypocalcemia and secondary hyperparathyroidism. Most patients have total alopecia in addition to rickets. The VDR exists two isoform with the MV 48 kDa and 54 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for VDR antibody 67192-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Antioxidants (Basel) Fibroblast Upregulation of Vitamin D Receptor Represents a Self-Protective Response to Limit Fibroblast Proliferation and Activation during Pulmonary Fibrosis | ||
Front Pharmacol Bacteroides dorei BDX-01 alleviates DSS-induced experimental colitis in mice by regulating intestinal bile salt hydrolase activity and the FXR-NLRP3 signaling pathway | ||
Front Cell Dev Biol Single-Cell Transcriptomics Reveals the Molecular Anatomy of Sheep Hair Follicle Heterogeneity and Wool Curvature. | ||
Eur J Pharmacol Vitamin D3 analogue calcipotriol inhibits the profibrotic effects of transforming growth factor- β1 on pancreatic stellate cells | ||
Phytomedicine Asperuloside inhibited epithelial-mesenchymal transition in colitis associated cancer via activation of vitamin D receptor.
| ||
Front Microbiol Vitamin D3 Suppresses Human Cytomegalovirus-Induced Vascular Endothelial Apoptosis via Rectification of Paradoxical m6A Modification of Mitochondrial Calcium Uniporter mRNA, Which Is Regulated by METTL3 and YTHDF3.
|