Validation Data Gallery
Tested Applications
| Positive WB detected in | THP-1 cells, mouse small intestine tissue, mouse cerebellum tissue, rat lymph tissue, rat spleen tissue, RAW 264.7 cells, mouse spleen tissue |
| Positive IP detected in | mouse spleen tissue |
| Positive IHC detected in | human lymphoma tissue, human ovary tumor tissue, mouse spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, RAW 264.7 cells |
| Positive FC (Intra) detected in | THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 10 publications below |
| WB | See 33 publications below |
| IHC | See 14 publications below |
| IF | See 11 publications below |
| IP | See 2 publications below |
Product Information
15940-1-AP targets TIPE2/TNFAIP8L2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7964 Product name: Recombinant human TNFAIP8L2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-184 aa of BC063014 Sequence: MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL 相同性解析による交差性が予測される生物種 |
| Full Name | tumor necrosis factor, alpha-induced protein 8-like 2 |
| Calculated molecular weight | 184 aa, 21 kDa |
| Observed molecular weight | 18-20 kDa |
| GenBank accession number | BC063014 |
| Gene Symbol | TIPE2 |
| Gene ID (NCBI) | 79626 |
| RRID | AB_2204663 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6P589 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
TIPE2 (TNF-α-inducible protein 8-like 2, or TNFAIP8L2), a negative immune regulator, is essential for maintaining immune homeostasis. TIPE2 shares considerable sequence homology with members of the tumor necrosis factor-α-inducible protein 8 (TNFAIP8) family, which are thought to regulate cellular and immune homeostasis. TIPE2 acts as a negative regulator of Toll-like receptor and T-cell receptor function and is preferentially expressed in lymphoid tissues. TIPE2 plays an essential role for a signal transduction pathway that links inflammatory immune response to specific conditions after cerebral ischemia
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for TIPE2/TNFAIP8L2 antibody 15940-1-AP | Download protocol |
| IF protocol for TIPE2/TNFAIP8L2 antibody 15940-1-AP | Download protocol |
| IHC protocol for TIPE2/TNFAIP8L2 antibody 15940-1-AP | Download protocol |
| IP protocol for TIPE2/TNFAIP8L2 antibody 15940-1-AP | Download protocol |
| WB protocol for TIPE2/TNFAIP8L2 antibody 15940-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Immunol Exosomes mediate the cell-to-cell transmission of IFN-α-induced antiviral activity. | ||
Nat Immunol Direction of leukocyte polarization and migration by the phosphoinositide-transfer protein TIPE2.
| ||
Sci Adv TIPE2 is a checkpoint of natural killer cell maturation and antitumor immunity.
| ||
Autophagy TNFAIP8L2/TIPE2 impairs autolysosome reformation via modulating the RAC1-MTORC1 axis.
| ||
J Exp Med TIPE2 specifies the functional polarization of myeloid-derived suppressor cells during tumorigenesis.
| ||
Cancer Immunol Res Tumor Necrosis Factor-α-Induced Protein 8-Like 2 Fosters Tumor-Associated Microbiota to Promote the Development of Colorectal Cancer. |














