Validation Data Gallery
Tested Applications
| Positive WB detected in | HCT 116 cells, HepG2 cells, mouse skeletal muscle tissue, HeLa cells, mouse spleen tissue, SW480 cells | 
| Positive IP detected in | HepG2 cells | 
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
| Positive IF/ICC detected in | HepG2 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below | 
| WB | See 18 publications below | 
| IHC | See 13 publications below | 
| IF | See 7 publications below | 
| IP | See 2 publications below | 
| RIP | See 1 publications below | 
Product Information
11114-1-AP targets TAP1 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse | 
| Cited Reactivity | human, mouse, rat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag1619 Product name: Recombinant human TAP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 509-808 aa of BC014081 Sequence: LYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE相同性解析による交差性が予測される生物種 | 
| Full Name | transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) | 
| Calculated molecular weight | 81 kDa | 
| Observed molecular weight | 70-81 kDa | 
| GenBank accession number | BC014081 | 
| Gene Symbol | TAP1 | 
| Gene ID (NCBI) | 6890 | 
| RRID | AB_2200201 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q03518 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
TAP1, also known as ABCB2, PSF1 or RING4, is a member of the ATP-binding cassette (ABC) family of transmembrane transporters and is an essential component of the major histocompatability complex (MHC) class I antigen-presenting pathway. TAP is involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I molecules. It also acts as a molecular scaffold for the final stage of MHC class I folding. Defects in TAP1 are a cause of bare lymphocyte syndrome type 1 (BLS1). Western blot analysis using this antibody detected a major band around 70-80 kDa in HeLa cells.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TAP1 antibody 11114-1-AP | Download protocol | 
| IHC protocol for TAP1 antibody 11114-1-AP | Download protocol | 
| IP protocol for TAP1 antibody 11114-1-AP | Download protocol | 
| WB protocol for TAP1 antibody 11114-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| Gastroenterology microRNA 125a Regulates MHC-I Expression on Esophageal Adenocarcinoma Cells, Associated With Suppression of Antitumor Immune Response and Poor Outcomes of Patients. | ||
| Nat Commun Proteomic analysis of archival breast cancer clinical specimens identifies biological subtypes with distinct survival outcomes. | ||
| Proc Natl Acad Sci U S A The herpesvirus UL49.5 protein hijacks a cellular C-degron pathway to drive TAP transporter degradation | ||
| Theranostics Nintedanib enhances the efficacy of PD-L1 blockade by upregulating MHC-I and PD-L1 expression in tumor cells. | ||
| Int J Cancer Antitumor efficacy of intermittent low-dose erlotinib plus sulindac via MHC upregulation and remodeling of the immune cell niche | ||
| Int J Mol Sci Antigen Peptide Transporter 1 (TAP1) Promotes Resistance to MEK Inhibitors in Pancreatic Cancers. | 









