Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse brain tissue, HEK-293 cells, L02 cells | 
| Positive IP detected in | HEK-293 cells | 
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 7 publications below | 
| IF | See 3 publications below | 
Product Information
21188-1-AP targets TAOK2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, monkey | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag15521 Product name: Recombinant human TAOK2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 742-969 aa of BC142663 Sequence: SLKVRAGQRPPGLPLPIPGALGPPNTGTPIEQQPCSPGQEAVLDQRMLGEEEEAVGERRILGKEGATLEPKQQRILGEESGAPSPSPQKHGSLVDEEVWGLPEEIEELRVPSLVPQERSIVGQEEAGTWSLWGKEDESLLDEEFELGWVQGPALTPVPEEEEEEEEGAPIGTPRDPGDGCPSPDIPPEPPPTHLRPCPASQLPGLLSHGLLAGLSFAVGSSSGLLPLL相同性解析による交差性が予測される生物種 | 
| Full Name | TAO kinase 2 | 
| Calculated molecular weight | 1235 aa, 138 kDa | 
| Observed molecular weight | 138-150 kDa | 
| GenBank accession number | BC142663 | 
| Gene Symbol | TAOK2 | 
| Gene ID (NCBI) | 9344 | 
| RRID | AB_10755293 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q9UL54 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
TAOK2(Serine/threonine-protein kinase TAO2) is also named as KIAA0881, MAP3K17, PSK, PSK1 and belongs to the protein kinase superfamily. TAOK2 is known to modulate gene transcription via its activation of several MAP kinase pathways, including c-Jun amino-terminal kinase (JNK), and has been implicated in the modulation of actin and microtubule dynamics. The time course of TAOK2 expression is consistent with a role for it in neuronal differentiation.(PMID:22735514). The immunogen of this antibody is 742-969 aa of human TAOK2 protein isoform Alpha.This antibody mainly detects the isoform 1/3/4. It can't detect the isoform 2.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TAOK2 antibody 21188-1-AP | Download protocol | 
| IP protocol for TAOK2 antibody 21188-1-AP | Download protocol | 
| WB protocol for TAOK2 antibody 21188-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| Am J Hum Genet Variants in EXOSC9 Disrupt the RNA Exosome and Result in Cerebellar Atrophy with Spinal Motor Neuronopathy. | ||
| Acta Neuropathol Commun A new TAO kinase inhibitor reduces tau phosphorylation at sites associated with neurodegeneration in human tauopathies. | ||
| Mol Cancer Ther Targeting TAO kinases using a new inhibitor compound delays mitosis and induces mitotic cell death in centrosome amplified breast cancer cells. | ||
| J Biol Chem Prostate-derived sterile 20-like kinases (PSKs/TAOKs) phosphorylate tau protein and are activated in tangle-bearing neurons in Alzheimer disease. | ||
| Mol Carcinog Targeting TAOK1 with resveratrol inhibits esophageal squamous cell carcinoma growth in vitro and in vivo | ||
| J Cell Sci Rnd3 interacts with TAO kinases and contributes to mitotic cell rounding and spindle positioning. | 








