Validation Data Gallery
Tested Applications
| Positive WB detected in | Jurkat cells, HepG2 cells, PC-12 cells |
| Positive IHC detected in | human gliomas tissue, human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 20 publications below |
| IHC | See 10 publications below |
| IF | See 3 publications below |
Product Information
11157-1-AP targets Stathmin 1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1633 Product name: Recombinant human STMN1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-149 aa of BC014353 Sequence: MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDFSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD 相同性解析による交差性が予測される生物種 |
| Full Name | stathmin 1/oncoprotein 18 |
| Calculated molecular weight | 18 kDa |
| Observed molecular weight | 18 kDa |
| GenBank accession number | BC014353 |
| Gene Symbol | Stathmin 1 |
| Gene ID (NCBI) | 3925 |
| RRID | AB_2197114 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P16949 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Stathmin 1 (STMN1) normally regulates microtubule dynamics either by sequestering free tubulin heterodimers or by promoting microtubule catastrophe. STMN1 is highly expressed in fetal and adult brain, spinal cord, and cerebellum. Many different phosphorylated forms are observed depending on specific combinations among the sites which can be phosphorylated. Phosphorylation of stathmin is involved in response to NGF, neuron polarization and microtubule polymerization inhibition activity. Increased expression of STMN1 has been observed in a variety of human malignancies, such as colorectal primary tumors and metastatic tissues, but its association with melanoma is so far not well known.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Stathmin 1 antibody 11157-1-AP | Download protocol |
| IF protocol for Stathmin 1 antibody 11157-1-AP | Download protocol |
| IHC protocol for Stathmin 1 antibody 11157-1-AP | Download protocol |
| WB protocol for Stathmin 1 antibody 11157-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Stem Cell Continuous clonal labeling reveals uniform progenitor potential in the adult exocrine pancreas. | ||
Chemosphere Perinatal exposure to nonylphenol impairs dendritic outgrowth of cerebellar Purkinje cells in progeny. | ||
Int J Nanomedicine Protein Nanoparticle-Related Osmotic Pressure Modifies Nonselective Permeability of the Blood-Brain Barrier by Increasing Membrane Fluidity. | ||
Oncogene KIAA1199 promotes metastasis of colorectal cancer cells via microtubule destabilization regulated by a PP2A/stathmin pathway.
| ||
Oncotarget Stathmin and phospho-stathmin protein signature is associated with survival outcomes of breast cancer patients. | ||
Neuroimage Developmental dynamics of the periventricular parietal crossroads of growing cortical pathways in the fetal brain - In vivo fetal MRI with histological correlation. |









