Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, Jurkat cells, K-562 cells, MOLT-4 cells | 
| Positive IP detected in | HeLa cells | 
| Positive IHC detected in | human cervical cancer tissue, human lung cancer tissue,  human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
| Positive IF/ICC detected in | K-562 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 10 publications below | 
| IF | See 1 publications below | 
| IP | See 1 publications below | 
Product Information
12071-1-AP targets STAT5A/B in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Cited Reactivity | human, mouse, rat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag2709 Product name: Recombinant human STAT5B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC020868 Sequence: MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAAT相同性解析による交差性が予測される生物種 | 
| Full Name | signal transducer and activator of transcription 5B | 
| Calculated molecular weight | 787 aa, 90 kDa | 
| Observed molecular weight | 90 kDa | 
| GenBank accession number | BC020868 | 
| Gene Symbol | STAT5B | 
| Gene ID (NCBI) | 6777 | 
| ENSEMBL Gene ID | ENSG00000173757 | 
| RRID | AB_2196933 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P51692 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
STAT5B belongs to the transcription factor STAT family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT5B carries out a dual function: signal transduction and activation of transcription. STAT5B mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. Although this antibody is a rabbit polyclonal antibody raised against residues near the N terminus of human STAT5B, the homology between this segment and the corresponding segment of human STAT5A is 95%. It shows that this antibody can cross-react with STAT5A.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for STAT5A/B antibody 12071-1-AP | Download protocol | 
| IHC protocol for STAT5A/B antibody 12071-1-AP | Download protocol | 
| IP protocol for STAT5A/B antibody 12071-1-AP | Download protocol | 
| WB protocol for STAT5A/B antibody 12071-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| Biomed Pharmacother Kuijieling regulates the differentiation of Treg and Th17 cells to ameliorate experimental colitis in rats. | ||
| Br J Pharmacol HSP90β shapes the fate of Th17 cells with the help of glycolysis-controlled methylation modification | ||
| Pharm Biol Yiguanjian decoction inhibits macrophage M1 polarization and attenuates hepatic fibrosis induced by CCl4/2-AAF. | ||
| Biochem Biophys Res Commun 1, 25(OH)2D3-induced interaction of vitamin D receptor with p50 subunit of NF-κB suppresses the interaction between KLF5 and p50, contributing to inhibition of LPS-induced macrophage proliferation. | ||
| Iran J Basic Med Sci Quercetin of huoxuehuayu tongluo decoction and azithromycin combination therapy effectively improves rat tubal factor infertility by inhibiting inflammation | 









