Recombinant human SIGMAR1 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag7351
Synonyms
FLJ25585; MGC3851; OPRS1; SR-BP1
Validation Data Gallery View All
Product Information
| Peptide Sequence |
SEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
(101-223 aa encoded by BC004899) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |

